KEGG   Pseudovibrio sp. FO-BEG1: PSE_1861Help
Entry
PSE_1861          CDS       T01669                                 

Gene name
fha
Definition
(GenBank) FHA domain protein
  KO
K11894  type VI secretion system protein ImpI
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_1861 (fha)
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSE_1861 (fha)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA
Motif
Other DBs
NCBI-ProteinID: AEV36371
UniProt: G8PG03
Position
1965995..1967494
Genome map
AA seq 499 aa AA seqDB search
MKLVLVINNTSTLENGSKATATFEKTGGSIGSGAQCHWQLMDRHNSVSREHVRVFFQDGV
YCAEAVGDEGIIVNGSNRPIPSGQRFRISDGDVWKVGAFKLTTYVVAEGSELEDHSEQWA
GRFAAIDTIVSGHLQDEDEQSQSNIEYILADRLESDLSEDFFASNQRSNALLCDPVEVLD
QQDEEGLPGNQDPLFQLNHDSEPEQQEQDEDLLGTLGLQPEYSGKAVGIDDPQAHHRLMI
MPQAKGNHAMSTTSTEPVDPEMDSYLESLTNSGGQEMLVSDIQETESWHGSVSLSETGEE
GMVDHVVLRPLLSALGLPIGDMSLPEANRITQEVGAALKTAISGLMSIHAQQWEDRSSMN
DTHLHPVEDNPIRLAQSPEQAIEDLLLVQSPVHLNAPSAIEESLMQIELHEKASRIAADE
ALEAVLFGLSPENLTKRFARYKGHAPRTGDLDSWNWQMYEHYYNEMRSGRQRGLTRMFWE
IFRQVYDREMRSHQLCAAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggttttagtcatcaacaacacctccacgttagagaacggcagcaaagccacc
gctacgtttgagaaaaccggcggaagtatcggttctggagcgcagtgccattggcagctg
atggataggcacaactccgtctcccgtgaacatgtgcgcgtgttctttcaggatggcgtc
tattgcgcagaagccgttggtgatgaagggatcatcgtaaacggttcaaaccggccaatt
ccgtccgggcaacgctttcgcatttcagatggtgatgtctggaaggttggggcgtttaaa
ctgacaacctatgtggtcgctgaaggaagcgaactggaggaccacagcgagcagtgggcg
ggccggtttgcagctattgataccatcgtgtcagggcatttgcaggatgaagacgaacag
tctcaaagcaacattgaatacatcttggctgatcgccttgagagcgatctgagcgaagac
ttttttgcgagcaatcaacgctccaacgcgcttctttgtgatccggttgaagttcttgac
cagcaagatgaagaaggcctgccgggaaatcaggaccctctcttccaactcaatcacgac
agtgagccggaacagcaagagcaggatgaagatcttctgggcacgctgggattgcaaccc
gaatacagcgggaaggcggtgggtatcgatgaccctcaagcgcatcaccgcctcatgatt
atgccccaagcaaaaggaaaccacgcaatgtccacgacgagtacagagccggttgacccg
gaaatggatagctatcttgaatccctgacgaactcgggcgggcaggaaatgctggtcagt
gatattcaggagaccgagagttggcatgggtcggtttctttatctgaaacgggcgaagaa
ggcatggtggatcacgtagtgctgcgtccactcctttcagcattgggactaccgattggc
gatatgagtttgcctgaggcaaaccgcattacccaagaagttggtgcggctttgaagact
gcgatttccggtctgatgtccattcacgctcagcagtgggaagatcggtcttccatgaac
gacacccatttgcatccggtggaagacaacccaatccgactggcgcaaagccctgaacag
gcaattgaagatttgctgcttgttcaaagccctgtgcacctgaatgcaccatccgccatt
gaagagagcctcatgcaaattgagttgcatgagaaggcaagccgtatcgctgctgacgaa
gctttggaagcggttctgtttggtctctctcctgagaacctgaccaaacgctttgcgcgt
tacaaagggcatgcgcctcgtacaggggacctcgatagctggaactggcagatgtacgag
cactactacaatgaaatgcgttcgggtcgacagcgcggactaacccgcatgttttgggag
atcttccgacaggtttacgaccgtgagatgcgcagccatcagctctgtgctgcggagtaa

DBGET integrated database retrieval system