KEGG   Pseudovibrio sp. FO-BEG1: PSE_2403Help
Entry
PSE_2403          CDS       T01669                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00620  Pyruvate metabolism
psf00630  Glyoxylate and dicarboxylate metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSE_2403 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSE_2403 (glcB)
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSE_2403 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase AphA_like
Motif
Other DBs
NCBI-ProteinID: AEV36911
UniProt: G8PMA8
Position
2543370..2545553
Genome map
AA seq 727 aa AA seqDB search
MSQRVSVASLQVSPELYNFVEKEALPGTGVTSDQFWEGFAQIIKDLTPRNRELLQIREDI
QTKIDDWHKANPDTIDLETYKTFLKELGYLLPEGESFDVDTANVDPEIAEIAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAMGSTPQAGGYDEARGAEVIAYARKKLDEALPLDE
GSWADVTEFAIMGGSLALTLENGDMAGLQDPLGFVGYAGNKDEPKSILLQKNGLHFDVLF
DRSSPIGAADKAGISDIILESAISTIMDCEDSVAAVDGEDKALAYCNWLGLMNGDLKEEV
SKGGKTFTRALNGDRHYTDAQGDALALKGRSLMLVRNVGHLMTNPAILDEDGNEVFEGIM
DAMVTSLCAIHDIGLREGATARNMNSVTGSVYIVKPKMHGPEEVAFADELFGRVEHVLEL
PRNTLKMGIMDEERRTTVNLKECIRAAKSRVCFINTGFLDRTGDEIHTSMEAGPMIRKAD
MKQATWISAYENHNVDTGLACGLREHAQIGKGMWAMPDLMHTMLEQKISHPKAGANTAWV
PSPTAATLHAMHYHQVCVPAVQEELSTREPAKLDDILSIPVATNPNWTPEDIQAEVENNA
QGILGYVVRWVEHGVGCSKVPDIHNVALMEDRATCRISSQHIANWLHHNVCSEEQVLEIM
KRMAAVVDEQNAGDPAYHNMAPDFDNSVAFQAACDLVFKGRIQPSGYTEPVLHKRRLEAK
AKFAASA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagagtaagtgttgcatcacttcaggtttcaccggaactctacaatttcgta
gagaaggaggctcttccgggcaccggagtgacatccgaccagttttgggaaggcttcgcg
cagatcatcaaggatctgacaccacgcaaccgcgaactgctccagatccgtgaagacatc
cagaccaagatcgacgactggcacaaagccaacccggacacgattgatctggaaacctac
aaaaccttcctcaaagaacttggctacctgctgcctgaaggtgaaagcttcgacgttgat
acagccaacgtcgacccggaaatcgcagagatcgccggtcctcagctcgttgtgcctgtc
atgaatgcgcgctacgccctcaacgctgccaatgcgcgttggggttccctgtatgatgcg
ctttacggcaccgacgccatgggctccacccctcaggcaggcggatacgacgaagcgcgc
ggcgcagaagtcatcgcctatgcccgcaagaagctggatgaggctctgcctctggatgag
ggcagctgggctgacgtcaccgagtttgccattatgggtggctcactggctctgacgctg
gaaaacggcgacatggcaggcctgcaggacccactcgggtttgttggctatgctggtaac
aaggacgagccaaagtccatcctgctgcagaaaaacggcctgcattttgatgtactgttt
gaccgctccagcccgatcggtgcagctgataaagcaggcatcagcgatatcattctggaa
tctgccatctccaccatcatggactgcgaagactctgttgcagctgtagacggtgaagac
aaagcactggcctactgtaactggctgggcctgatgaatggcgacctgaaagaagaagtt
agcaaaggcggcaaaaccttcacccgtgccttgaatggtgaccgtcactacaccgatgcg
cagggcgatgctctggcgctgaagggccgctccctcatgctggtgcggaacgtcggtcat
ctcatgaccaacccggcgatccttgatgaggatggcaatgaggtctttgaaggcatcatg
gacgctatggtgacctccctctgcgcgatccacgatatcggcctgcgtgaaggtgcaact
gcccgcaacatgaactccgtaaccggctccgtttacatcgtgaagccaaagatgcacggc
ccggaagaagttgctttcgcggacgagctgtttggccgcgtggaacatgttttggagctg
ccacgcaacaccttgaaaatgggtatcatggatgaggaacgccgcaccacggtcaacctc
aaagagtgcatccgtgccgccaagtctcgtgtatgcttcatcaacaccggcttccttgac
cgcactggtgacgagatccacacctccatggaagctggcccaatgatccgcaaggcggac
atgaagcaggccacatggatcagcgcttatgagaaccacaatgtagacaccggccttgcc
tgtggtctgcgtgagcatgcgcaaatcggcaaaggcatgtgggccatgccagacctgatg
cacaccatgctggagcagaagatcagccatccaaaagcgggcgctaacaccgcatgggtg
ccatcgccaaccgcagcaaccctgcatgccatgcactaccatcaggtctgtgtaccagcc
gttcaggaagaactgtcgacccgtgaacctgcaaagctggatgatatcctgtccattccg
gttgccaccaatccaaactggacaccggaagacattcaggcagaagttgagaacaacgcg
caaggcatccttggatacgttgtgcgctgggtagagcacggtgtcggctgctccaaagtg
ccggacatccataatgtggctttgatggaagaccgcgcaacctgccgcatctcctcgcag
cacatcgccaactggctgcaccacaatgtctgctctgaagagcaggtgctggagatcatg
aagcgcatggctgctgtggtggatgagcagaatgcaggcgacccggcctatcacaacatg
gcgcctgactttgacaactccgtcgccttccaggctgcatgtgatctggtcttcaaaggc
cgcatccagccaagcggttacacagaaccagtgctgcataaacgccgccttgaagccaag
gcgaagttcgccgcatcagcctga

DBGET integrated database retrieval system