KEGG   Pseudovibrio sp. FO-BEG1: PSE_2524Help
Entry
PSE_2524          CDS       T01669                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00300  Lysine biosynthesis
psf01100  Metabolic pathways
psf01120  Microbial metabolism in diverse environments
psf01230  Biosynthesis of amino acids
Module
psf_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PSE_2524
Enzymes [BR:psf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PSE_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AEV37032
UniProt: G8PNB5
Position
complement(2679583..2680896)
Genome map
AA seq 437 aa AA seqDB search
MRDELRQSVESKVEELVALTRDLIAFPTINPPGEAYRPCAEFIGERLRRKGFQVEYVRGE
STPGDSDRYPRINVICRYEGRGPGPCVHFNSHIDVVEVGYGWTVDPFAGVVKDGKVFGRG
ACDMKGGLASSIIAAETLIECFPEFCGAIEISGTVDEESGGLGGVAYLARHGYFSKPRVD
HVIIPEPLHKDQVCLGHRGVWWSEIETRGSIAHGSMPFLGDSAIRHMGAFLNVLEDELYP
ALSKKQTQMPVIPPGARSSTLNINSLHGGQDEGHDGLPSPCVADSCRIVLDRRFLIEEPL
EDVKQEIVEILENLRKTRRNFEYELKDLLEVLPVMADKDSPVARAVADGIKDVLQKDASY
VVSPGTYDQKHITRLGHLHDCIAYGPGKLEMAHRPDEFVGIEDLVDSAKVMALAAYSLLT
EPDASPITRTQSDHVHS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgggatgaactcaggcaatctgtcgagagcaaagtagaggagcttgtggctctgaca
cgagatctgattgcgtttccaactatcaatcctcccggagaggcttatcggccttgcgcc
gagttcattggggaacgcttgaggcgcaaaggcttccaggttgagtatgtcagaggtgaa
agcacccctggcgactctgatcgttatccacgcatcaatgtcatctgtcggtatgaggga
cgaggccctgggccttgcgttcatttcaactcacacattgatgtggttgaagttggatat
ggctggacggttgatccgtttgccggggttgtcaaagacggtaaggtctttgggcgcggg
gcctgcgatatgaagggcggtttggcttcttccattatcgcagcagaaaccctgattgag
tgttttcctgagttttgcggtgctattgagatctcaggcaccgttgatgaagagtcaggt
gggcttggcggcgtggcttaccttgccagacatggatatttctccaagcctcgcgttgat
catgtgatcatccctgaaccgctgcataaagatcaggtttgcctcgggcacagaggtgtg
tggtggagtgagatcgagactcgcggctccattgcccacggctcaatgccgttcttggga
gacagcgcaattcgtcacatgggggcatttttgaatgtgcttgaagacgagctttaccct
gcgctcagcaaaaaacaaacacaaatgccggttattcctcccggcgcccgatcatctact
ttaaatatcaactcgttacatggcgggcaggatgaaggacatgacggtcttccctcccct
tgcgttgcggatagctgccgcatcgtactggatcgtcgctttctgattgaagagcctttg
gaggacgtgaaacaagagatagttgaaatattagaaaatctgcgtaaaacacgtagaaat
ttcgaatatgaacttaaggatctccttgaagttctgcctgtgatggccgacaaagactcc
ccagtcgcgcgcgcggtcgcagacggaattaaagacgtgcttcaaaaggatgcgtcatat
gtggtctctccggggacatatgatcagaagcacataacacggcttggccacttgcacgat
tgtattgcgtatggtccaggcaaacttgagatggcgcacaggccggacgaatttgttgga
attgaggatctcgtagacagcgcaaaagtaatggcactggcggcgtactctcttcttaca
gagcctgatgcaagcccaataacaagaacacagtctgatcacgtgcactcttaa

DBGET integrated database retrieval system