KEGG   Pseudovibrio sp. FO-BEG1: PSE_2853
Entry
PSE_2853          CDS       T01669                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_2853
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_2853
SSDB
Motif
Pfam: VipB T6SS_VipA
Other DBs
NCBI-ProteinID: AEV37361
UniProt: G8PSP8
Position
complement(3046289..3048286)
AA seq 665 aa
MNDAEKDDDLDSLLNDIIEESDAPAEGGSAESASASVFEPDFGEIDCEAPKLNITLESPF
HLAVIGDFSGRANRMALYTADELAVLKGHNVDVDTAEDLPARFKINIELDLAGDDKVIRF
EPRCIEDFHPDEIIEEFEIFDELKALRSSLKNPGTFSSAAATIDEWLENQGEKPVSQRNS
RGSVIAVDKKLSDFSALIDRPVEEHEEVDDLSEMIGKMVSPYIKAADNPQLDDYLEIVEE
VMTTTLRKILQNADFQALESVWRVIDMLSRRIETSTSLKITLYDISAEDFARDLSATNKL
EETGLYRLFVENALQDEGVGTPSAIVGLYTFDMTPPHAELLGRMSKICAHAHAPFLTSLD
RNNANRKFEELPKITEKTWQSLKAMPESNYIGLSLPRFMLRMPYGAKTDPIDAFDFEEFD
EKIGLKAMLWGNPAALVGLVLAKDYETNGGGMRPGSILTINDMPFHYVHDQYGDQVALPC
TDRMISHRSVEPLMRQRFMPIVSMKGQPEVRIASLSGLAGDIVSGRWCDQIAVSKAAETP
SASAGARVSIAGGDGYNPAIQATKGAVVVETILDPKKTPETVFRIETETPEPQVKEPAAA
EDEDEDVEEAAPAPAPKPAAAAAPPEPAHDTSELDNLLADLSADDEDEADEEGMDPELEA
LLADL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgaatgacgctgaaaaagacgatgaccttgactcgctgcttaacgacatcatcgaggaa
agtgacgcccctgccgaaggtggaagtgccgagagcgcttctgccagcgtgtttgaacca
gattttggcgagatcgactgcgaagcgccaaagctgaacattacgctggaaagccccttc
catctggcggtcattggcgatttctcaggccgtgccaatcggatggcgctttatacagca
gatgagcttgctgtgcttaaaggccataatgttgatgttgatacggcagaagatctccca
gcccgttttaagatcaacattgagctggaccttgcaggtgatgacaaggttatccggttt
gaaccacgctgcattgaagacttccatcccgatgagatcatcgaagagttcgagatcttt
gatgagctgaaagctctgcgatcttctttgaagaacccagggaccttcagcagcgcagct
gcaaccattgatgaatggctggaaaaccagggcgagaagcctgtttctcagcggaactcc
cgcggctctgtgattgccgttgacaagaagctcagtgacttttctgctttgattgaccgg
cctgtcgaagagcatgaagaagtcgatgatctttccgaaatgatcggcaaaatggtctcg
ccttacatcaaagcagccgacaatccgcagctcgacgattatcttgagatcgttgaggaa
gtgatgacgacaacccttcgcaagatcctgcaaaatgcagattttcaggcattggagagt
gtctggcgggttattgatatgttgtcacgccggattgagacttccacatccttgaagatc
acgctctacgacatttcagcggaagattttgctcgtgacctgagcgcgaccaacaagctg
gaagaaacaggtctgtatcgtctgttcgtagaaaatgcactgcaggatgaaggtgttggc
acgccaagtgctatcgtgggcctttacacattcgacatgacacctccgcatgcggagctt
cttggtcgcatgtcaaagatctgtgctcatgctcatgcgccgttcctgacttctctggat
cgcaacaacgcaaacagaaaatttgaagagcttcctaagattaccgaaaagacgtggcag
agtcttaaggctatgccagagagcaattacattggtctgagcttgccacgcttcatgctt
cggatgccctatggagcaaaaaccgatccgattgatgcattcgactttgaagagtttgac
gagaagattggcctgaaagccatgttgtggggtaacccggcagcactggtcggccttgtg
ctcgcaaaagactatgagaccaatggtggcggcatgcggccaggttcgatcctgaccatc
aacgatatgccgttccattacgtgcatgaccagtacggcgatcaagtcgccctgccctgt
acagaccgcatgatcagtcaccgcagcgttgaacctttgatgcgacagcggttcatgccg
attgtttccatgaaaggacagccggaagtccggatcgcctctctgagtggccttgccgga
gatattgtttccggtcgctggtgtgatcagattgcggtttccaaagcagcagaaacccca
agcgcaagtgctggtgcgcgcgtcagcattgctggcggtgacggttataaccctgccatt
caggcaacgaagggtgctgtggttgttgaaaccatcctggatcctaagaagaccccggaa
accgtcttcaggatcgaaacagaaacacctgaacctcaagttaaagaacctgcggctgca
gaagacgaggacgaagacgtcgaagaagcagctccggcacctgcaccaaaacctgcagca
gcggctgctccacctgaacctgcccatgacacatctgagctggacaacctgctagctgat
ctatctgcagatgatgaagacgaagctgacgaagaaggtatggatccagagctcgaagct
ctgcttgccgacctataa

DBGET integrated database retrieval system