KEGG   Pseudovibrio sp. FO-BEG1: PSE_2857
Entry
PSE_2857          CDS       T01669                                 

Definition
(GenBank) Type VI secretion system
  KO
K11896  type VI secretion system protein ImpG
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
KEGG Orthology (KO) [BR:psf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psf02044]
    PSE_2857
Secretion system [BR:psf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSE_2857
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEV37365
UniProt: G8PSQ2
Position
complement(3053150..3055027)
AA seq 625 aa
MKPWLLPYYNRELQHIRESASEFAEAYPKVAGRLGLSGFDCADPYVERLLEGFAFLTARV
QYKLDAQFPQFTQHLLEMVYPHFLAPVPSMLIASLEPDMTQGSLKEGYLVPRGTQLRSRK
SARGATPCTYKTAHDTTLWPVSVEAVDYLASPSELAAQKVEVRNGAKAGLRIRLKTVGNI
PFNELALDELPLYLRGGGSQPVKLYEQIIGNCAGVAIRPTSLPTPWEINLPSEIVNTRGY
GDEDALLPYGPQSFSGYRLLQEYFAFPHRFLFAELTNLQPAVRQCETDEMDVFLLFNRVD
RDLERAVDRANIALFCTPAINLFSTRLDRLHINDRRSDHHVVPDRSKPLDYEIYQLEEVE
GYSSQGDAPQIFKPFYSLSSSQDIRSESAYYTVHRKQRLATAKRKITGGRSNYLGTEIFI
SLVDAKDAPYNLSLNQLGIRALCTNRDLPLMMPIGAGKSDFSLPEGGPVNAVKCIDGPSR
PRPSNIFGETAWRFINHLSLNYLSIADNNDTDGAQALRSILHLYAPLGDTSTTQQIDGVR
SIKSTRAVRRLPGRGLSSVARGLELNITLDEAAFEGTGVFLLGAVLNEFFARYVSINSFT
ETVVRSSVRGEVMRWPCQIGRRHRL
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgaagccttggctgcttccttattacaacagagaattacagcacatacgcgaaagtgcc
tcagaatttgcagaggcatatcccaaggttgcaggccgtctcgggctgagtggctttgac
tgtgcagacccttacgtggagcggttactagagggctttgcgtttctgacagcgcgcgtt
caatacaagctggatgctcagttccctcagtttacgcagcatcttcttgagatggtgtat
ccgcattttctggcgcccgtgccatccatgttgattgccagccttgagccagacatgaca
cagggctcattgaaggaaggctatctggttcctcgcggaactcaattgcgcagccggaaa
agtgcacgcggagcaacgccttgtacctacaagacggctcacgacacgaccttatggcct
gtcagcgtagaagcagtcgactatcttgcgagcccgagtgaactggcggcacagaaggtt
gaagtgcgcaacggtgcaaaggctggacttcgcatacggctgaagaccgttggcaacatt
cccttcaatgaattggcgctggatgaactccctctctatttgcgaggtggcggttcacag
ccggtgaagctctacgagcagattatcggtaactgtgcgggcgttgccattcgcccgaca
agcctgccgacaccatgggaaatcaatctcccctctgaaatcgtgaacacacgcggttat
ggagatgaagatgctctgctcccctacggccctcaatctttcagcggatatcgtttgctg
caggagtactttgcttttccccataggttcctgtttgcagaactgacgaatctacaacca
gctgttcgccaatgtgaaaccgatgagatggatgttttcctgctcttcaatcgggttgac
agggatctggagcgcgccgttgatcgcgctaatattgcgttgttttgtacgccagccatc
aatctgttctccacgcgactggatcgcttgcacataaacgacaggcgcagcgatcaccat
gtggtgccggatcgttccaagccgctggactatgagatctatcagctggaagaagtggaa
ggctacagctctcagggtgatgcgccgcagatcttcaagccattttacagcctctcaagt
tctcaggatattcgcagtgagagcgcctattacacagttcatcgaaaacaacgcctagca
accgctaagcggaagattacgggcggtcgtagtaactatctgggcaccgagatcttcatc
agtctcgtagatgcgaaagatgcgccgtataatctatcgctcaatcagctgggcattcgc
gctctttgcacaaaccgcgacttgccgttgatgatgccgattggcgcaggcaaatcagac
ttttcgcttccagaaggtggtccagttaatgcggtgaagtgtattgacggaccaagccgc
cctcgtccctccaacatctttggtgaaacggcatggcggttcatcaaccatttgtcactg
aactacctcagcattgcggataataacgacaccgatggagcacaagccttgcgttccatt
ctgcatctttatgcgccgctgggagatacctctacgacgcagcagatagatggtgttcga
tctatcaaatctacccgagcagtgcgtcgtctccctgggcgtggcctctcttctgttgcc
cgtggtctggagctgaacattacgctcgatgaagccgcgtttgaaggcacgggtgtgttt
ctcttgggagcggtgctcaacgagttcttcgcgcgttacgtatcgatcaacagcttcacg
gaaaccgtggtgagatcgagcgttcgtggtgaagtgatgcgttggccatgtcagattggg
aggcgtcataggctatga

DBGET integrated database retrieval system