KEGG   Pseudovibrio sp. FO-BEG1: PSE_3128Help
Entry
PSE_3128          CDS       T01669                                 

Gene name
nosZ
Definition
(GenBank) Nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00910  Nitrogen metabolism
psf01120  Microbial metabolism in diverse environments
Module
psf_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PSE_3128 (nosZ)
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PSE_3128 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2
Motif
Other DBs
NCBI-ProteinID: AEV37636
UniProt: G8PG62
Position
3350248..3352077
Genome map
AA seq 609 aa AA seqDB search
MGAVAAAGAGGFAPARAAEGGLKYHVGPGELDEYYGFWSSGQTGELRIMGLPSMRELMRI
PVFNRCSATGWGQTNESKKILQENMLPETKEFLAAHGMEHYDNGDLHHPHMSFTEGTYDG
RYLFMNDKANTRVARVRCDVMKCDKITEIPNAHDIHGLRPQKYPRTGYVFANGEHEAPLV
NDGTILDEPDKYSCIFTALDGDTMEVAWQVIVTGNLDNCDADYQGKYAFSTSYNSEMGTN
LAEMTASEMDHCVVFNIKRIEEGVKNGDYQMLNGVPVLDGRKGSKYTAYIPVPNSPHGCN
TCPDKKHLMINGKLSPTVSVIDVTKLDAVFDGADPRSAVVAEPELGLGPLHTAFDNRGFA
YTTLFLDSQMVKWDIDKAIRQYAGEDVDPIHSKIDVAYQPGHNHTSMGETSEADGKWLVS
LNKFSKDRFLNVGPLKPENEQLIDISGDEMKIVHDGPTFAEPHDVIIVHNSVVNPASVWQ
RDDPMFADAVAQAKADGVDLEEAEHVIRDGNKVRVYMHSAAPTFSLEKFTVKQGDEVTVY
VTNIDDIDDLTHGFCISNYNVAMEIGPQATASVTFIAERPGVHWFYCQWFCHALHMEMRG
RMFVEPRDA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgccgttgctgcagcaggcgctggtggttttgcaccagctcgcgctgctgaaggt
ggcctcaagtaccatgtaggtccaggcgagctggacgaatactatggcttctggtcatca
ggtcagaccggcgaactgcgcattatgggtctgccatccatgcgcgaactgatgcgtatt
cctgtattcaaccgttgttctgcaaccggttggggtcagaccaacgaatctaagaagatt
ctgcaggaaaacatgctgccagaaaccaaagagttcttggctgcgcatggcatggaacac
tacgacaacggtgacctccaccacccacatatgtccttcaccgaaggtacatatgacggt
cgttacctgttcatgaacgacaaagcgaacacccgtgttgcacgtgtacgctgtgacgtt
atgaaatgtgacaagatcaccgagattccaaacgcacacgacatccacggtctgcgtcct
cagaagtacccacgtactggctacgtcttcgcaaacggtgagcatgaagctccactcgta
aacgacggcacaatcctggatgagccagataagtacagctgcatcttcactgcactcgat
ggtgataccatggaagttgcatggcaggtcatcgtaaccggtaacctggacaactgtgac
gctgactatcagggtaaatacgctttctctaccagctacaactcagaaatgggtacaaat
ctggcagaaatgacagcctctgaaatggaccactgcgttgtattcaacatcaaacgcatc
gaagaaggcgtcaaaaacggcgactaccagatgctgaatggtgttcctgttcttgatggc
cgtaaaggctccaagtacaccgcgtacatccctgtaccaaacagcccacacggctgtaac
acctgcccagataaaaaacacctgatgatcaacggtaaactgtctccaacagtttctgtt
atcgacgtgaccaaactggacgcagtattcgacggcgcagatccacgctccgcagttgtt
gctgaaccagagctgggtcttggcccactccacactgcattcgataaccgcggcttcgct
tacaccactctgttcctcgacagccagatggttaagtgggacatcgacaaagcgatccgt
cagtatgcaggcgaagacgtcgatccaattcactcaaaaatcgatgtggcttaccagcca
ggtcacaaccacacctctatgggtgaaacatcagaagcagacggcaagtggcttgtttct
ctgaacaagttctctaaagaccgcttcctgaacgttggtcctctgaaaccagaaaacgaa
cagctgatcgatatttctggcgatgaaatgaaaatcgttcacgatggtcctacctttgca
gaaccgcacgacgtcatcatcgtacacaactccgttgtgaacccagcatctgtctggcag
cgtgacgacccaatgttcgctgatgctgtcgcacaggctaaagctgacggtgtggatctg
gaagaagcagaacacgtcatccgcgacggcaacaaagttcgtgtttacatgcattctgct
gcaccaaccttctctcttgagaagttcacagttaagcagggcgacgaagttaccgtttat
gtcaccaacattgatgacatcgatgacctgacacacggcttctgtatttctaactacaac
gtggcaatggaaattgggcctcaggcaactgcttccgtaacctttatcgcagagcgtcca
ggtgttcactggttctattgccagtggttctgtcatgcactgcacatggaaatgcgcggt
cgtatgttcgttgagccacgcgacgcataa

DBGET integrated database retrieval system