KEGG   Pseudovibrio sp. FO-BEG1: PSE_3294Help
Entry
PSE_3294          CDS       T01669                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00020  Citrate cycle (TCA cycle)
psf00620  Pyruvate metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
Module
psf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_3294 (pdhC)
   00020 Citrate cycle (TCA cycle)
    PSE_3294 (pdhC)
   00620 Pyruvate metabolism
    PSE_3294 (pdhC)
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSE_3294 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3
Motif
Other DBs
NCBI-ProteinID: AEV37802
UniProt: G8PI10
Position
complement(3531752..3533089)
Genome map
AA seq 445 aa AA seqDB search
MPINILMPALSPTMEEGNLAKWLVKEGDAISAGDVIAEIETDKATMEVEAVDEGTIGKIM
VAEGTEGVKVNAPIAILLEEGEDASAMDAAPAAAPAPAAAAPQAPATPAAPAAAAAPAPA
PAAPVAASGERVFSSPLARRLAKQNGLDIALIAGSGPKGRVVKRDVEAAIAAGTGKAEAA
PKAAEAPKAAEAPKAAPAGASDEQTLKLFEEGSYDLVPHDGMRKVIAKRLTESKQTVPHF
YLTVECELDALLALRAQLNSSAPTDADGKPAYKLSVNDMIIKAHALALKAIPAANASYLE
SGMVMHKHADVGVAVSIDGGLITPIIRRAEEKTLSTISIEMKDLAKRARERKLAPTEFQG
GTTSVSNLGMFGVKEFAAVINPPHATILAVGAGQKRPVVKGDEIVPATVMSVTLSTDHRA
VDGALGAELLQAFKGYIENPMSMLV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaacattttgatgcctgcgctttctccaaccatggaagaaggcaatctggcc
aagtggctggttaaagaaggtgacgcgatttctgcaggcgacgtgattgcagagatcgaa
accgacaaagcgaccatggaagtggaagcagtcgatgaaggcaccatcggtaagatcatg
gttgctgaaggaaccgaaggcgtgaaggtgaatgcaccgatcgcgatccttctggaagag
ggcgaagacgcttctgcaatggacgccgcaccagctgcggctcctgcaccagcggctgct
gctcctcaggctcctgcgacgccagctgcgcctgcggctgcggcggctcctgcaccagct
ccagcggctccggttgctgcttctggtgagcgtgtgttctcttctcctctggcacgccgt
ctggcgaaacagaatggtctggacatcgctctgatcgctggcagcggccctaaggggcgc
gttgtgaagcgtgacgttgaagctgcgattgctgctggcaccggtaaagcggaagctgct
cctaaggctgcggaagctccaaaagcggctgaggctccaaaggctgcaccagctggtgct
tctgatgagcagaccctcaagctgtttgaggaaggctcttacgatctggttcctcacgat
ggtatgcgcaaggttattgcgaagcgcctgacagaatccaagcagaccgttccacacttc
tacctgactgtggagtgtgagctggatgctctgctggctctgcgtgctcagctgaactct
tccgctccaactgacgctgatggcaagcctgcttacaagctttccgtcaacgacatgatc
atcaaggcgcatgcgctggcactgaaagcaattccagctgcaaacgcatcctaccttgag
agcggcatggttatgcataagcatgctgacgttggtgttgcagtttccatcgatggtggt
ctgatcactccgatcatccgccgcgctgaagagaaaacgctctccaccatctccatcgag
atgaaagacctggcgaagcgtgctcgtgagcgcaagctggctccaaccgaattccagggc
ggtacgacttccgtttccaaccttggcatgttcggcgtgaaggaatttgctgcggtgatc
aacccaccacacgcaaccatccttgctgttggcgctggtcagaagcgtccggttgtgaag
ggcgatgagatcgttcctgcgactgtgatgtctgtgaccctttccactgaccaccgcgcg
gtggacggtgcgctgggtgcagaacttctgcaggccttcaaaggctacatcgaaaacccg
atgtccatgctggtttaa

DBGET integrated database retrieval system