KEGG   Pseudovibrio sp. FO-BEG1: PSE_3767Help
Entry
PSE_3767          CDS       T01669                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00970  Aminoacyl-tRNA biosynthesis
psf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSE_3767
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psf03029]
    PSE_3767
Enzymes [BR:psf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PSE_3767
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PSE_3767
Mitochondrial biogenesis [BR:psf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PSE_3767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AEV38271
UniProt: G8PNG6
Position
complement(4106675..4108162)
Genome map
AA seq 495 aa AA seqDB search
MTVTDLTKLTIAEARDKLAARDFTATELTESYLGAIESGNEALNAYVAVTGDIAREQAKA
SDAKIAAGEARPLEGIPLGIKDLYATKGVHTQACSHILDGFKPEYESTVTQNLFDDGAVM
LGKLNMDEFAMGSSNETSFYGNVVNPWRRNGTETALVPGGSSGGSASAVAAHLCAAATAS
DTGGSIRQPAALTGTVGIKPTYGRCSRWGMVAFASSLDQAGPIGRTVRDNAILLKSMASV
DAKDTTSVDAPVPNYEEFVGKSIKGMKIGIPKEYHMDGIPAEIEALWQQGIAWLKEAGAE
IVEISLPHTKYALPAYYIVAPAEASSNLARYDGVRYGLRVPGNDIVEMYENTRAAGFGDE
VKRRVMIGTYVLSAGYYDAYYLKAQKVRTLIKQDFDNAWADGVDAILTPTTPDAAFAPGE
ITDPVTMYMNDVFTVTANMAGVPGMSIPAGLNKDGLPLGLQLIGKPFDEGTLFQVGEVIE
QAAGRFEPSANWWSK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgactgatcttaccaaactgacgatcgcagaggcgcgcgacaagcttgctgcc
cgcgactttaccgcaactgaactgactgagagctacctgggtgctatcgagtccggcaat
gaagcgctgaatgcgtatgttgctgtgactggtgatattgcccgtgagcaggctaaagcg
tctgatgcaaaaatcgctgctggtgaagcgcgtccgctggaaggtattcctctcggcatt
aaagacctttacgcgaccaaaggtgttcacactcaggcgtgttctcatatccttgatggc
ttcaagccagagtatgagtccaccgtaacgcagaacctgtttgacgacggcgctgtgatg
ctgggtaagctgaacatggatgagttcgcgatgggctcttccaatgagacttccttttac
ggcaatgttgtaaacccttggcgccgcaatggcactgagactgcgttggttcctggtggt
tcttctggtggttccgcttctgcggttgctgcgcacctttgtgctgctgcaacagcttct
gataccggtggttccattcgtcagcctgcagcgctgaccggtactgttggcatcaagcca
acctatggccgttgctctcgctggggtatggttgcgtttgcgtcttctctggatcaggct
ggtccgattggccgtactgtgcgtgacaacgcgatcctgctgaagtccatggcttctgta
gatgcaaaagacaccacttctgttgatgcgcctgtgccgaactacgaagagttcgttggc
aagtccatcaagggcatgaagatcggtatccctaaagagtaccacatggatggtattcca
gcggagatcgaggcgctctggcagcagggcattgcatggctgaaggaagctggcgctgag
atcgtcgagatttctctgccgcacaccaagtacgctctgcctgcttactacatcgttgca
ccagcggaagcttcttccaacctggcgcgttacgatggtgttcgctacggtctgcgtgta
ccgggcaacgacattgtagagatgtatgagaacactcgtgcagctggctttggtgatgaa
gtgaagcgccgcgtgatgattggcacctacgttttgtctgcaggttactatgacgcgtac
tacctgaaggcgcagaaggttcgtaccctgatcaaacaggactttgacaatgcgtgggca
gacggtgtggatgcaatcctgacaccaaccaccccagatgctgcgtttgctccgggtgag
atcactgatccagtgaccatgtacatgaatgacgtgttcaccgtgactgcgaacatggct
ggcgtaccaggcatgtccatcccagctggcctcaacaaagacggcctgccactgggcctg
cagctgatcggtaaaccattcgacgaaggcaccctgttccaggttggcgaagtcatcgaa
caggccgctggccgcttcgagccttccgccaactggtggagcaaataa

DBGET integrated database retrieval system