KEGG   Pseudovibrio sp. FO-BEG1: PSE_3874Help
Entry
PSE_3874          CDS       T01669                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PSE_3874 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psf03011]
    PSE_3874 (rplV)
Ribosome [BR:psf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PSE_3874 (rplV)
  Bacteria
    PSE_3874 (rplV)
  Archaea
    PSE_3874 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEV38378
UniProt: G8PPG5
Position
complement(4201198..4201578)
Genome map
AA seq 126 aa AA seqDB search
MGKQKHERTLADNEAKAVARMLRVSPQKLNLVAASIRGKKVGTALADLTFSRKRISGDVK
KCLMSAIANAENNHDLDVDNLVVAEAFVGKALVMKRFQPRARGRVGRILKPFSNLTIVVR
EVEEAA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcagaagcatgagcggacgctcgccgacaatgaggctaaagcagtagctcgt
atgctgcgcgtttctccacagaaactcaatctcgttgctgcatcgatccgcggtaagaag
gttggtactgctcttgctgacctgaccttctcacgcaagcgtatctctggcgatgtcaag
aaatgcctgatgtctgctattgcaaacgctgaaaacaaccatgatctcgacgtcgacaac
cttgtcgtcgccgaggcattcgttggcaaggcgcttgtaatgaagcgtttccagccacgt
gcccgtggtcgtgttggacggattctgaagccgttctccaacctgaccatcgtggttcgt
gaagttgaggaggcagcctga

DBGET integrated database retrieval system