KEGG   Pseudovibrio sp. FO-BEG1: PSE_4004Help
Entry
PSE_4004          CDS       T01669                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00900  Terpenoid backbone biosynthesis
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSE_4004 (ispE)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PSE_4004 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEV38508
UniProt: G8PR81
Position
4342910..4343791
Genome map
AA seq 293 aa AA seqDB search
MTLEDTKAARVEELARAKVNLALHITGQREDGYHLLDSLVVFPKVGDRIAVETAPDLSLQ
ITGDFAEKIQGDPSDNLVYKAAQLLAEHVPNASGTRIELEKSLPVAAGIGGGSADAAATL
RALAKLWGTSPAPTDLARLSLSLGADVPMCLEEKPARIRGIGEVIEPVAGFPSGAIVLVN
PMIEISTPTIFRALEKKDNAPLPEMPEEFESMKALANWLKSCRNDLQKPAISQAAEISEV
LDLLASQPDTLLARMSGSGATCFALCKTLEDAQSITTHLQDLHSDWWIRAAEV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgactttggaagacacaaaggcagcacgggttgaggagttagcccgtgccaaggtgaac
cttgccctccacatcaccggtcagcgcgaagacggctatcacctgctcgacagtctggtc
gtctttccaaaggtgggcgaccgcatcgccgtagaaactgcaccggacctgtcactacag
atcaccggtgattttgcagaaaagatacagggcgatccttccgacaacttggtctacaaa
gcggcacagctgctggcagaacacgttccaaatgcatccggcacccgcattgaactggaa
aaatccctgcccgtcgcagcaggcattggcggaggttcagcagatgcagccgcaaccctg
cgcgcccttgccaaactctgggggacctctccggcgccgacagatttagccagactctct
ctcagcctcggcgctgatgtacccatgtgtcttgaagaaaaaccggcccgcatccgcggc
attggcgaagtcatcgagccagttgcgggcttcccatcgggagccatcgtactggtcaat
ccaatgatcgagatctccaccccgaccatcttccgtgcgcttgaaaagaaagacaacgcg
cctctgccggaaatgccggaagagtttgagagcatgaaggccctcgccaactggctcaaa
tcctgccgcaacgacctgcaaaagccagcgatttcacaggctgccgaaatctcagaagta
ctggaccttctggcctcccagccagataccctcctcgcccgcatgtccggctccggcgcc
acctgcttcgccctttgcaaaaccctggaggacgcccaatccatcaccacccacttgcag
gacctccacagcgactggtggatcagagcggcagaggtgtag

DBGET integrated database retrieval system