KEGG   Pseudovibrio sp. FO-BEG1: PSE_4778Help
Entry
PSE_4778          CDS       T01669                                 

Gene name
pldB
Definition
(GenBank) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PSE_4778 (pldB)
Enzymes [BR:psf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSE_4778 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: AEV39280
UniProt: G8PKX0
Position
complement(5149872..5150819)
Genome map
AA seq 315 aa AA seqDB search
MLMLLVDTDFNRVPEGTESGFVQTEDNVKIRWARWAPTGSPLKGTVTIVQGRTEFIEKYF
EVVEELRARGFYVVAFDLRGQGGSERLLKNERRGHVESFDEFALDLHAVLDNVSLSDCPG
PHFLLGHSTGGAVVMHANRRLKTKIDRAVLTAPLVGLAMSGRIRKFAGALAKSLVWVGMG
NAFVPGGNDKILVDYDGNTLTSDPDRFKRMNDILEAAPQLGLGSPTVSWFRAMGMATERF
KEPEFQIEFGVPSLVIGAGRDEIVSTDDAEELCRSCPGMSFLEIRGSRHEILMERDPYRE
QFWAAFDAFIPGSAD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgctgctggttgatacggatttcaatcgtgttcctgaaggaaccgagtctggc
tttgtgcagacggaagacaatgtgaaaatccgttgggcacgctgggctccgacagggtct
cccctgaagggaacggtgaccattgttcaggggcggaccgagtttattgagaaatacttc
gaggtcgttgaggagctacgcgcacgtggcttttatgtggtggcctttgatctgcgcggg
cagggtggttcagagcggttgctgaagaatgagcgacgtggccacgttgaaagctttgat
gaatttgcgctggatctgcacgctgttctcgacaatgtgtctctctctgattgtcccggt
ccacacttcctgcttgggcactcgacaggtggcgctgtggtgatgcatgcgaaccggcgt
ctcaaaacaaagattgatcgtgctgttttgactgctccgctggtgggccttgcaatgagc
gggcggattcgcaagtttgcaggagctttggcgaaaagcctggtctgggtcggaatgggg
aatgcgtttgttcccggtggcaacgacaagatcctcgttgactatgatggcaacactctc
acttctgatcctgatcgcttcaagcgcatgaacgatattcttgaagctgcaccacagttg
gggcttggttcgccgaccgtgagctggttccgtgcgatgggcatggcgactgagcgcttt
aaagagccggagtttcagattgagtttggcgtcccgtccttggtgattggtgccggacgg
gatgaaattgtttcgacggatgatgccgaagagctgtgccgctcgtgtcctggcatgagc
tttcttgaaattcgaggatctcgccacgagattttaatggagcgagatccttatcgtgag
cagttctgggctgcgtttgacgcgtttattcccggaagcgctgattaa

DBGET integrated database retrieval system