KEGG   Pseudovibrio sp. FO-BEG1: PSE_p0060Help
Entry
PSE_p0060         CDS       T01669                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00071  Fatty acid degradation
psf00072  Synthesis and degradation of ketone bodies
psf00280  Valine, leucine and isoleucine degradation
psf00310  Lysine degradation
psf00362  Benzoate degradation
psf00380  Tryptophan metabolism
psf00620  Pyruvate metabolism
psf00630  Glyoxylate and dicarboxylate metabolism
psf00640  Propanoate metabolism
psf00650  Butanoate metabolism
psf00900  Terpenoid backbone biosynthesis
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
psf01212  Fatty acid metabolism
psf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSE_p0060
   00630 Glyoxylate and dicarboxylate metabolism
    PSE_p0060
   00640 Propanoate metabolism
    PSE_p0060
   00650 Butanoate metabolism
    PSE_p0060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSE_p0060
   00072 Synthesis and degradation of ketone bodies
    PSE_p0060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSE_p0060
   00310 Lysine degradation
    PSE_p0060
   00380 Tryptophan metabolism
    PSE_p0060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSE_p0060
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSE_p0060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSE_p0060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psf04147]
    PSE_p0060
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSE_p0060
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSE_p0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEV39642
UniProt: G8PV54
Position
unnamed:complement(65758..66966)
Genome map
AA seq 402 aa AA seqDB search
MATTAYVYDAIRTPRSKGKPDGSLNEVKPINLVTTLLDEMQSRHDLDTSRVDDVVMGCVT
PVREQGAVLPKIALQKAGWDQTVAGAQVNRFCASGLDTFNSAAARIASGWEDMICAGGYE
SMSRAPMGTDGGPFSEDPETVLATGFVPQGIGADLIATIEGWSRDDVDAAAVASQQRAAH
ARDNGWFDKSVVPVKDENGIIVLEKDDFIKPNTDMQALGALRPSFEKHGAMGFDAVALAR
YPEVEKINHVHTPGNSSGIVDGASLILLGSEQVGKDMGLTPRARVLSVAVTASDPTIMLT
GPGPASKKALAKAGLTIDDIDLVEINEAFASVMMRLQKDLNVPDEKLNVVGGAIAMGHPL
GATGGMLVSTMIDELERRNQKRALITMCVGGGMGIASIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacagcatacgtctatgatgcgatccgcactccgcgttccaaaggaaagccg
gacgggtctctcaacgaagtcaaaccaatcaatctggtgaccacactgctggatgaaatg
caaagccggcacgacctcgacacctcccgggtggatgatgttgtcatgggctgtgtgaca
ccggtacgcgaacagggcgctgttctgccaaagattgccttgcagaaagcgggctgggat
cagaccgtggcaggggcgcaggtcaaccgtttctgtgcgtctggtctggataccttcaac
tccgctgcagcgcgcatcgcgtccggctgggaggatatgatctgcgcaggcggctatgaa
agcatgagccgcgcgccgatgggtaccgatggtggtccgttcagcgaagaccctgaaacc
gtgcttgccaccggctttgtaccgcagggcatcggtgcagacctgatcgctacgatcgag
ggctggagccgtgatgatgtagatgcagcagccgtcgccagccagcaacgtgcagcacat
gcgcgcgataacggttggttcgacaagtccgttgtgccggtgaaggatgagaacggcatc
atcgttttagaaaaagatgacttcatcaagccaaacacggatatgcaggcactgggtgct
ctgcgtccaagctttgaaaagcatggcgccatgggttttgatgcggtggcattggcccgc
taccctgaagttgaaaagatcaaccacgtccacacaccgggcaactcctccggcatcgtg
gatggtgcttcactgatcctgcttggcagtgaacaggtgggcaaggacatgggcctgacc
ccacgtgcccgcgtgctctcagtagcggtcactgcctctgacccaaccatcatgctcacc
ggaccgggaccagcttccaagaaggcactcgccaaggcaggtctgaccattgatgacatc
gatctggttgagatcaacgaagcttttgcctctgtgatgatgcgtcttcagaaggacctc
aacgtgccggatgagaagctgaacgttgttggtggtgcgatcgccatgggtcatccactg
ggcgcaaccggcggcatgctggtgtccaccatgatcgacgagctggagcgccgtaaccag
aagcgtgcgctgatcaccatgtgtgttggtggcggcatgggcatcgcgtccatcatcgag
cgcgtataa

DBGET integrated database retrieval system