KEGG   Pseudomonas aeruginosa B136-33: G655_01415Help
Entry
G655_01415        CDS       T02627                                 

Definition
(GenBank) sulfate ABC transporter permease
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00920  Sulfur metabolism
psg02010  ABC transporters
Module
psg_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    G655_01415
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_01415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_01415
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    G655_01415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF2273 Keratin_assoc
Motif
Other DBs
NCBI-ProteinID: AGI79208
Position
complement(305381..306250)
Genome map
AA seq 289 aa AA seqDB search
MSSASISAATASASRRGNAGGRLALIVLAWLVFALFLLLPLYVVLSEALKQGFGTFFEAI
LEPDALAALKLTLIAVAISVPLNLLFGVAAAWCVSKFEFRGKSILVTLIDLPFSVSPVIA
GLIYVLLFGAQGYFGEWLSDHDIQIVFAVPGIVLATLFVTVPFVARELIPLMQEQGTQEE
EAARLLGANGWQMFWHVTLPNIKWGLIYGVVLCTARAMGEFGAVSVVSGHIRGVTNTLPL
HVEILYNEYNHVAAFSVASLLLLMALVILLLKQWSESRMSRLKSNADEE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgcaagcatttccgctgccaccgccagcgcctcccgccgcggcaacgccggc
ggccgcctggccctgatcgtcctggcctggctggtcttcgccctgttcctcctgctgccg
ctctacgtggtcctgagcgaggcgctgaagcagggtttcggcaccttcttcgaggcgatc
ctcgaacccgacgcgctggccgcgctgaagctgaccctgatcgcggtggccatctcggtg
ccgctcaacctgctgttcggcgtcgccgccgcctggtgcgtgagcaagttcgagtttcgc
ggcaagagcatcctggtgaccctgatcgacctgccgttctcggtctcgccggtgatcgcc
ggcctgatctacgtgctgttgttcggcgcccagggctacttcggcgaatggctgagcgac
cacgacatccagatcgtcttcgcggtgcccggcatcgtcctggcgaccctcttcgtcacc
gtgcccttcgtcgcccgcgaactgatcccgctgatgcaggaacagggcacccaggaagag
gaggccgcccgcctgctcggcgccaacggctggcagatgttctggcacgtgaccctgccg
aacatcaagtggggcctgatctacggcgtggtgctctgcaccgcccgggcgatgggcgag
ttcggcgcggtgtcggtggtttccggacacatccgcggcgtcaccaacaccctgccgctg
cacgtcgagatcctctacaacgaatacaaccacgtcgccgccttcagcgtcgccagcctg
ttgctgctgatggcgctggtcatccttctgctcaagcagtggagcgaatcccgcatgtcc
cgactgaaaagcaatgctgacgaggaatga

DBGET integrated database retrieval system