KEGG   Pseudomonas aeruginosa B136-33: G655_03935Help
Entry
G655_03935        CDS       T02627                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    G655_03935
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     G655_03935
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     G655_03935
    1.1.1.-  
     G655_03935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C DAO 2-Hacid_dh_C UDPG_MGDP_dh_N Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGI79712
Position
complement(841633..842694)
Genome map
AA seq 353 aa AA seqDB search
MRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPVFIPVEAPHPL
TGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHGLYNICENLAF
TGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGSLLGQNVVVVG
AGTIGLCTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDALGEIRALTGGL
GADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEKQLLGALAYNG
EFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVSPGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgccgtctggcacggccgccacgatatccgcgtggaagacgtgccgctcccg
gccgagccgccgcccggctgggtgcagatccgcgtgcactggtgcggcatctgcggctcc
gacctgcacgaatacctggccggcccggtattcatccccgtggaggcgccgcacccgctc
accggcctcaaggaccaatgcatcctcggccacgagttcagcggcgaaatcgtccgcctc
ggcaacggcgtgaccggcttcgccgtcggccaggcggtcgccgcagacgcctgccagcat
tgcggcacctgctactactgccggcatgggctgtacaacatctgcgagaacctggccttc
accgggctgatgaacaacggcgccttcgccgaatacgtcaacgtaccggccaacctgctc
tacgccctgccggccggatttcccagcgaggccggcgcgctgatcgagccgctggcggtg
ggcatgcacgcggtgaagaaggccggcagcctgctcgggcagaacgtggtggtggtcggc
gccggcaccatcggcctgtgcaccatcatgtgcgcgcgcgccgccggcgcggcacaggtg
atcgccctggagatgtcctcggcgcgcaaggccaaggccctggaggtcggcgccagccag
gtgctcgacccctcgcggtgcgacgccctaggcgaaatccgcgccctcaccggcgggctt
ggcgccgacgtcagcttcgaatgcatcggcaacaagcacaccgccaagctggccatcgat
gccatccgcaaggccggcaaatgcgtgcttgtgggaatcttcgaggagcccagtgaattc
aatttcttcgagctggtttccaccgagaagcagttgctcggggccctcgcctacaacggc
gagttcgccgacgtgatcgccttcatagccgacggccgcctcgacatcgcaccgctggtg
accggtcgcatcggcctggaagaaatcgtcgagcgcggtttcgaagagttggtgaacaac
aaggagcacaacgtgaagatcatcgtctcgccgggcggctga

DBGET integrated database retrieval system