KEGG   Pseudomonas aeruginosa B136-33: G655_05250Help
Entry
G655_05250        CDS       T02627                                 

Definition
(GenBank) ABC transporter permease
  KO
K05846  osmoprotectant transport system permease protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_05250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_05250
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    G655_05250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGI79975
Position
complement(1127812..1128474)
Genome map
AA seq 220 aa AA seqDB search
MDFFSVLSHLDWSQIGQLTLQHLLLVLVAVGLAILVGVPLGVLMTRFTWLAGPLQGAATV
MLTIPSIALFGLLMPVYSVFGQGLGPLPAITAVFLYSLLPILRNTYLALTGVEAGISEAG
KGIGMTFWQRLRMVDIPLAVPVILAGVRTAVVMNIGVMTIAAVIGAGGLGVLILTSISQS
NMPMLVVGAVLVSLLAIVADLLLQWLQRILTPKGLRASAH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggacttcttcagcgtgctttcccatctcgactggtcccagatcggccagctcaccctc
cagcacctgctgctggtactggtcgccgtgggcctggcgatcctcgtcggcgtgccgctg
ggcgtgctgatgacccgcttcacgtggctggccggcccgctgcagggcgccgccacggtg
atgctgaccatcccctcgatcgccctgttcggcctgctgatgccggtctactcggtattc
ggccagggcctcgggccgctgccggcgatcaccgcggtgttcctctattcgctgctgccg
atcctgcgcaacacctacctcgccctgaccggcgtcgaagcgggcatcagcgaggccggc
aagggcatcggcatgaccttctggcaacgcctgcggatggtcgacattcccctcgcggtg
ccggtgatcctcgccggcgtacgcaccgccgtggtgatgaacatcggcgtgatgaccatc
gccgcggtgatcggcgccggcggcctgggcgtgctgatcctcacttccatcagccagagc
aacatgccgatgctggtggtcggcgcggtactggtcagcctcctggccatcgtcgccgac
ctgctgctgcaatggctgcaacgcatcctcacccccaagggactgcgcgccagcgcgcac
tga

KEGG   Pseudomonas aeruginosa B136-33: G655_05260Help
Entry
G655_05260        CDS       T02627                                 

Definition
(GenBank) ABC transporter permease
  KO
K05846  osmoprotectant transport system permease protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_05260
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_05260
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Osmoprotectant transporter
    G655_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGI79977
Position
complement(1129409..1130131)
Genome map
AA seq 240 aa AA seqDB search
MVKTCGKALLGLCAAAAVLALLIHWITPATILHYREDLLFYLQAHLVLVFSSMAAALLVG
VPAGILLSRPGMQAQAERLMQVFNVGNTIPPLAVLAIALAIIGIGNGPAILALFLASLLP
IVRNTYEGLRNVSPALKEAATGIGMTPNQVLLRVELPNAVPIIVGGVRVALALNVGSAPL
AFLIGANSLGSLIFPGIYLNNHQQLLLGAACTALLALLLDALVVLFSRMFLERGLTAKEA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaacctgtggcaaggccctgctcggcctctgcgccgcagccgccgtactggcc
ttgctgatccactggatcacccccgcgaccatcctccactaccgcgaggacctgctgttc
tacttgcaggcccacctggtgctggtcttcagttcgatggcggccgccctgctggtcggc
gtgccggccggcatcctgctcagccgtcccggcatgcaggcccaggccgaacgcctgatg
caggtgttcaacgtcggcaacaccatcccgccgctggcggtgctggccatcgccctggcg
atcatcggcatcggcaacggcccggcgatcctcgccttgttcctcgcctcgctgctgccg
atcgtgcgcaacacctacgagggtctgcgcaatgtctcgccggcgctgaaggaagccgcc
accggcatcggcatgacgcccaaccaggtgctgctgcgggtggaactgccgaacgcggtg
ccgatcatcgtcggcggcgtgcgcgtggccctggcgctgaacgtcggctccgcgccgctg
gcgttcctgatcggcgccaacagcctgggcagcctgatcttccccggcatctacctgaac
aaccaccagcaactgctgctcggcgccgcctgcacggcgctcctcgccctgctgctggac
gccctggtggtgctgttcagccgcatgttcctggaacgcggcctgaccgccaaggaggcc
tga

DBGET integrated database retrieval system