KEGG   Pseudomonas aeruginosa B136-33: G655_06850Help
Entry
G655_06850        CDS       T02627                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00071  Fatty acid degradation
psg00072  Synthesis and degradation of ketone bodies
psg00280  Valine, leucine and isoleucine degradation
psg00310  Lysine degradation
psg00362  Benzoate degradation
psg00380  Tryptophan metabolism
psg00620  Pyruvate metabolism
psg00630  Glyoxylate and dicarboxylate metabolism
psg00640  Propanoate metabolism
psg00650  Butanoate metabolism
psg00900  Terpenoid backbone biosynthesis
psg01100  Metabolic pathways
psg01110  Biosynthesis of secondary metabolites
psg01120  Microbial metabolism in diverse environments
psg01130  Biosynthesis of antibiotics
psg01200  Carbon metabolism
psg01212  Fatty acid metabolism
psg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G655_06850
   00630 Glyoxylate and dicarboxylate metabolism
    G655_06850
   00640 Propanoate metabolism
    G655_06850
   00650 Butanoate metabolism
    G655_06850
  09103 Lipid metabolism
   00071 Fatty acid degradation
    G655_06850
   00072 Synthesis and degradation of ketone bodies
    G655_06850
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    G655_06850
   00310 Lysine degradation
    G655_06850
   00380 Tryptophan metabolism
    G655_06850
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    G655_06850
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    G655_06850
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G655_06850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psg04147]
    G655_06850
Enzymes [BR:psg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     G655_06850
Exosome [BR:psg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G655_06850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGI80295
Position
1474801..1476006
Genome map
AA seq 401 aa AA seqDB search
MLDAYIYAGLRTPFGRHAGALSTVRPDDLAGLLLARLAETSGFAVDDLEDVILGCTNQAG
EDSRNLARNALLAAGLPARLPGQTVNRLCASGLSAVIDAARAISCGEGRLYLAGGAESMS
RAPFVMAKAESAFSRTLEVFDSTIGARFANPRLVERYGNDSMPETGDNVARAFGIAREDA
DRFAASSQARYQAALEEGFFLGEILPVEVRAGRKGETRLVERDEHPRPQADLAALARLPA
LFAGGVVTAGNASGINDGAAVVLLGDRAIGEREGIRPLARILANASVGVEPRLMGIGPQQ
AILRALQRAGIDLDEVGLIEINEAFAPQVLACLKLLGLDYEDPRVNPHGGAIALGHPLGA
SGARLVLTAARGLQRIERRYAVVSLCVGLGQGVAMVIERCR
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgcctatatctacgccggcctgcgtacgcctttcggccggcatgccggtgca
ctctcgacggtgcgtccggacgacctggccggcctgctgctggcgcgtctcgcggaaacc
tccgggttcgccgtcgacgacctggaggatgtgatcctcggttgcaccaaccaggccggc
gaagacagccgcaacctggcgcgcaacgcgctgctcgcagccggcctgccggcgcggctg
cccgggcagacggtcaaccgcttgtgtgccagcggactgtcggcggtgatcgacgcggcg
cgcgcgatcagttgcggcgagggccggctgtacctggccggcggcgccgaaagcatgtcc
cgggcgccgttcgtcatggccaaggcggagagcgccttcagccgcacgctggaggtcttc
gacagcaccatcggcgcgcgcttcgccaaccccaggctggtcgagcgctatggcaacgac
agcatgccggagaccggcgacaacgtggcccgcgccttcggcatcgcccgcgaggacgcc
gaccgtttcgccgcttcttcccaggcgcgctaccaggctgcgctggaggagggctttttc
ctcggcgagatccttccggtggaggtgcgtgccggacgcaagggcgagacgcggctggtg
gagcgcgacgagcatccgcggccgcaggccgacctggcggccctggcgcgcttgccggcg
ttgttcgccggcggggtagtgaccgccggcaatgcctcggggatcaacgacggggcggcg
gtagtgctgctgggcgatcgcgcgatcggcgagcgcgagggcatccggccgctggcgcgg
atcctcgctaacgccagcgtcggcgtggagccccggttgatgggcatcggcccgcagcag
gcgatcctccgcgcgctgcaacgcgccggcatcgacctggacgaggtcggcctgatcgag
atcaacgaagccttcgcgccgcaggtcctggcctgcctgaagttgctcggcctggactac
gaggacccgcgggtcaatccccatggcggcgccatcgcccttggccatccgctcggtgcc
tccggtgcgcgcctggtgctcaccgccgcccgcgggctgcaacgcatcgagcggcgctac
gcggtggtcagcctgtgcgtcgggctcggccagggcgtggcgatggtgatcgagcgctgc
cgatga

DBGET integrated database retrieval system