KEGG   Pseudomonas aeruginosa B136-33: G655_07455Help
Entry
G655_07455        CDS       T02627                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00020  Citrate cycle (TCA cycle)
psg00620  Pyruvate metabolism
psg01100  Metabolic pathways
psg01110  Biosynthesis of secondary metabolites
psg01120  Microbial metabolism in diverse environments
psg01130  Biosynthesis of antibiotics
psg01200  Carbon metabolism
Module
psg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G655_07455
   00620 Pyruvate metabolism
    G655_07455
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     G655_07455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AGI80414
Position
complement(1622650..1624221)
Genome map
AA seq 523 aa AA seqDB search
MKKILLMLLCVSVLGCSKNSVESEKPVDVLLIGGGIMSATLGTYLNELEPGWTIEMVERL
DKVAEESSNGWNNAGTGHSAFCELNYTSEAADGSMDISKAVAINENFEISKQFWAYQVDR
KVLNDPKSFINNVPHMSFVWGDDNVAFLKKRHAALQHSSLFRGMEYSEDPEQIKQWVPLV
MEGREPGQKIAATRMSIGTDVNFGEITRQLVGSLSAKDTFKLRLQHEVRDLKRNDDNTWT
VTMADLANGDKETSVKARFVFIGAGGGALKLLQMSGIPEAEGYAGFPVGGSFLATTNPDV
VKRHLAKVYGKASVGSPPMSVPHLDTRMIDGKPVLLFGPFATFSTKFLKNGSLWDLPGSV
TSSNIGPMFNAGIDNFDLSQYLIGQLMLSQDDRMASLREYFPEARDEDWKLVQAGQRVQI
IKKDAEKGGVLQFGTEVVTAADGSVAALLGASPGASTAAPIMLSVLEKAFKDKVATPEWQ
ARLKEIVPSYGRKLNNDIELTNSTRAWSSERLQLIHVPVQPEA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcttattgatgcttttgtgcgtcagcgtgctgggttgctccaaaaacagc
gtcgaatcggaaaaaccggtcgacgtgctcctgatcggtggcggcatcatgagcgccacc
ctgggtacctatctgaacgaactggaaccaggctggaccatcgagatggtcgagcgcctg
gacaaggtcgccgaggaaagctccaacggctggaacaatgcgggcaccggtcactcggcg
ttctgcgaactgaactacaccagcgaggccgcggacggctcgatggatatcagcaaggcg
gtggcgatcaacgagaacttcgagatctccaagcagttctgggcctaccaggtcgaccgc
aaggtgctgaacgatccgaagtcgttcatcaacaacgtcccgcacatgagcttcgtctgg
ggcgacgacaacgtcgccttcctcaagaagcgccacgccgccctgcagcacagctcgctg
ttccgcggcatggagtactcggaagaccccgagcagatcaagcagtgggtgccgctggtg
atggaaggccgcgagccggggcagaagatcgccgccacgcgcatgtcgatcggcaccgac
gtcaacttcggcgagatcacccgccaactggtgggctcgctgtcggccaaggacaccttc
aagctgcgcctgcaacatgaggtccgcgacctcaagcgcaacgacgacaacacctggacc
gtgaccatggccgacctggccaacggcgacaaggaaaccagcgtcaaggccaggttcgtc
ttcatcggcgccggtggcggcgcgctgaagctgctgcagatgtccggcatccccgaggca
gaaggctatgccggcttcccggtgggcggttcgttcctcgccactaccaacccggacgtg
gtcaagcgccatctggccaaggtctacggcaaggcttcggtgggttcgccgccgatgtcg
gtgccgcacctcgacacccgcatgatcgacggcaagccggttctgctgttcggtccgttc
gccaccttctccaccaagttcctgaagaacggctcgctgtgggacctgccgggctcggtg
accagcagcaacatcggcccgatgttcaacgccggcatcgacaacttcgatctcagccag
tacctgatcggccagctgatgctcagccaggacgaccgcatggcctcgctgcgcgagtac
ttcccggaagcccgcgacgaggactggaagctggtacaggccggccagcgcgtgcagatc
atcaagaaggacgccgagaaaggcggcgtactgcaattcggcaccgaagtggtgaccgcc
gccgacggctccgtcgccgccctgctcggcgcctcgccgggcgcctcgaccgccgcgccg
atcatgctgtcggtgctggagaaggccttcaaggacaaggtcgccacccccgagtggcag
gcacgcctgaaggaaatcgtgccgtcttacgggcgcaagctgaacaacgacatcgagctg
accaacagcacccgtgcctggagcagcgagcgcctgcaactgatccacgtgccggtacag
ccggaggcctga

DBGET integrated database retrieval system