KEGG   Pseudomonas aeruginosa B136-33: G655_10175Help
Entry
G655_10175        CDS       T02627                                 

Definition
(GenBank) histidine transport
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_10175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_10175
Enzymes [BR:psg01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     G655_10175
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    G655_10175
   Histidine transporter
    G655_10175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 MeaB AAA_33 AAA_16 AAA_25 AAA_23 PRK AAA_13 G-alpha AAA_22
Motif
Other DBs
NCBI-ProteinID: AGI80958
Position
complement(2199477..2200244)
Genome map
AA seq 255 aa AA seqDB search
MYSLQVEDIHKRYGSHEVLRGVSLRAGKGDVISIIGSSGSGKSTFLRCVNFLEKPCAGRI
RVGDEELRTRPGALGELRAADPRQLQRIRSRLAMVFQHFNLWSHLTVLENVVECPVNVLR
MNRDDAVARARHYLAKVGLAEKVERQYPCELSGGQQQRVAIARALAMEPQVMLFDEPTSA
LDPELVGEVLKVMQQLAEEGRTMVLVTHEMAFARQVSSHVIFLHQGVIEEQGTPDQVFGA
PRSERLRQFLAGNLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcctgcaggtcgaagacatccacaagcgctacggcagccatgaggtgctcagg
ggcgtttcgctcagggccggcaagggagacgtgatcagcatcatcggctcctccggctcg
ggcaaaagcaccttcctgcgctgcgtcaacttcctggaaaagccctgtgccgggcgcatc
cgcgtcggcgacgaggaactgcgcacccgtcccggcgccctgggcgagctgcgcgccgcc
gatccccggcagttgcagaggatccgcagccggctggcgatggtcttccagcatttcaac
ctgtggagccacctgacggtgctggagaacgtggtcgagtgcccggtcaacgtcctgaga
atgaaccgcgacgacgccgtggcccgcgcgcgccactacctggccaaggtcggcctggcg
gagaaggtcgaacggcagtatccctgcgaactctccggcggccagcaacagcgcgtggcg
atcgcccgcgccctggccatggagccgcaggtgatgctgttcgacgaaccgacctcggcg
ctcgatccggaactggtcggcgaagtgctgaaagtcatgcagcagttggccgaggaaggt
cgcaccatggtcctggtcacccacgagatggccttcgcccgccaggtttccagccatgtg
atcttcctccaccagggcgtgatcgaagagcaagggacgccggaccaggtgttcggcgcg
ccgcgcagcgagcgcctgcgccagttcctcgccggcaacctgaaatga

DBGET integrated database retrieval system