KEGG   Pseudomonas aeruginosa B136-33: G655_10185Help
Entry
G655_10185        CDS       T02627                                 

Definition
(GenBank) histidine transport system permease
  KO
K10016  histidine transport system permease protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_10185
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_10185
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    G655_10185
   Histidine transporter
    G655_10185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGI80960
Position
complement(2200975..2201664)
Genome map
AA seq 229 aa AA seqDB search
MFLDGFGPQILAGTLVTLKLALGSLLGAVLIGLLGASAKLAANRPLRALASGYTTLIRSV
PDLVIMLLLFFSLQILLNRVTDALGIAQVDIDPFAAGCVTLAFIYGAYFTETFRGAFQAV
PAGQVEAAQAYGMGRWRVFRRVLLPQMLRYALPGIGNNWQVLVKSTALVSIIGLGDLVKA
TQDAGKGTLQFFHFTLVCGLIYLAITAISNTALLWLERRSSLGVRRPLP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcgacggcttcggcccgcagatactcgccggcaccctggtgaccctgaaactg
gcgctgggctccctgctcggcgccgtgctcatcggcctcctcggcgccagcgccaagctc
gccgccaaccgcccgctgcgcgccctggccagcggctatacgacgctgatccgcagcgtc
cccgacctggtcatcatgctgttgctgttcttcagcctgcagatcctcctcaaccgcgtc
accgacgccctcggcatcgcccaggtcgacatcgacccgttcgccgccggctgcgtcacc
ctggcgttcatctatggcgcctacttcacggaaaccttccgcggcgccttccaggcggta
ccggccggccaggtcgaagccgcgcaagcctacggcatggggcgctggcgagtgttccgc
cgggtactcctgccgcagatgctgcgctacgccctgccgggcatcggcaacaactggcag
gtgctggtcaagtccaccgcgctggtctcgatcatcggcctcggcgacctggtcaaggcc
acccaggacgccggcaagggcaccctgcagttcttccacttcaccctggtctgcgggctg
atctacctggccatcaccgcaatctccaacaccgcgctgctgtggctggagcggcgcagc
tcgctgggcgtcaggaggccgctgccatga

DBGET integrated database retrieval system