KEGG   Pseudomonas aeruginosa B136-33: G655_16830
Entry
G655_16830        CDS       T02627                                 

Definition
(GenBank) serine-threonine kinase Stk1
  KO
K11916  serine/threonine-protein kinase Stk1 [EC:2.7.11.-]
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
KEGG Orthology (KO) [BR:psg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psg02044]
    G655_16830
Enzymes [BR:psg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     G655_16830
Secretion system [BR:psg02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   G655_16830
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 APH_6_hur Kdo
Other DBs
NCBI-ProteinID: AGI82282
Position
complement(3708169..3709158)
AA seq 329 aa
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAG
GMGTVYRARDLLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRL
FTFDVDTACQRAYIVMELMPGLPLDRLLCERPEGLPWSELSAIARPLLDALAYVHEQGVL
HGDLKPSNVMLGEEGVRLFDFGLGQAQAGILDGLPQLSRGRIDAWTPGYAAPELLEGAPL
SPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQLRAPGHLPRRCWPALRTALSL
DPERRCIGVRELQEALGARRSWLAGVLAR
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaacgaaccgctgtcgtcgctggagctgctgccggaggaggagggcggcgcgaacctg
acctatttcgccttcgccgccccgaccgcctcggcgccggacctgccggcggtgttgccc
ggtccgctgccggacgttctttccgggcgctaccgtctggagcggatgctcggcgccggc
ggcatgggcacggtataccgtgcccgggacctgctccatgagcagttcggcgacccggcg
ccgctggtagcgttgaagctgctcaacgaatcggtcgccgagtcacccgacgccagcgcc
ttgctctatagcgagttcgccctgacccggcgcttgcgccatccgaacgtcgtgcgtctg
ttcaccttcgacgtcgacaccgcctgccagcgcgcctacatcgtcatggaactcatgcct
ggcctgccgctcgatcgcctgctctgcgagcgtcccgaaggcctgccctggtccgagttg
agcgcgatcgcccggccgttgctggacgccctggcctatgtccacgaacaaggggtgctg
catggcgacctgaagccgagcaacgtgatgctcggcgaggagggcgtgcggctcttcgac
ttcggcctcggccaggcgcaggcaggcatcctggacggcctgccgcagctcagccggggc
cgcatcgacgcctggaccccgggctacgccgctcccgaactgctcgagggtgcgccgttg
tcgccggcagccgacctgtatgcgctggcctgcgtcctctacgaactggccgacggtcgc
catccgttccgccgcctgccctcgaaccaggcccgggagcaggggctggagcgccagctg
cgcgcgcccggacacctgcctcggcgctgctggccggcgctgcgtaccgccctgagcctc
gaccccgaacggcgctgcatcggcgtccgcgaattgcaggaagcgctgggcgcgcggcgt
tcctggctggccggcgttcttgcccgttga

DBGET integrated database retrieval system