KEGG   Pseudomonas aeruginosa B136-33: G655_16870
Entry
G655_16870        CDS       T02627                                 

Definition
(GenBank) transcriptional regulator
  KO
K11914  sigma-54 dependent transcriptional regulator
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
KEGG Orthology (KO) [BR:psg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psg03000]
    G655_16870
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psg02044]
    G655_16870
Transcription factors [BR:psg03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    G655_16870
Secretion system [BR:psg02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   G655_16870
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 HTH_8 AAA_5 GAF_2 HTH_30 HTH_50 AAA_16 AAA_2 HTH_1 AAA AAA_7 TIP49
Other DBs
NCBI-ProteinID: AGI82290
Position
complement(3717578..3719089)
AA seq 503 aa
MFSRVPQPLAFAEALLAQFGALSRETDIAALLGGFARAVGELSGCELSQLYLLDQTHTAL
TLNAECRDGLLQALEPSSLPADYTGEQLLQFALCQNRVVSLVDLPSRLHETGFLPAGEQP
WLSLLCVPLVSPEKTVEGMVVCATRRPLDLQGFAHPLGQLGSFVLAQLHLLQRLSQPSGE
PQGPSSAPVVSGYGLIGRSAAMRETCRLISKVLHNPYTVLLQGETGTGKEVVARAIHEYG
PRRAQAFVVQNCAAFPENLLESELFGYRKGAFTGAERDRPGLFDAADGGTLLLDEIGDMP
LSLQAKLLRVLQEGEIRPLGGNDTHKVDVRIIAATHRDLALLVRDGKFREDLYYRLAQFP
IELSPLRQREGDALELARHFAERACVFLRRAPLGWSAEALELLDGYGFPGNVRELKGLVE
CAVLLCEGDVLLAEHFSLRAPPEAEAPLKLREHLEQIERDLLLACLRRNAGNQTLAAREL
GLPRRTLIYRMGRLNIHFGDPRT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgttcagccgcgtaccgcaacccctggccttcgccgaagccctgctcgctcagttcggc
gcgctgtcgcgggaaacagacatcgcggccctgctgggcggtttcgcacgcgcagtcggc
gaactcagcggctgcgagctgagccagctgtatctgctcgaccagacccataccgcgctc
accctcaacgccgaatgccgggacggcctgttgcaggcgctggagccgtcgagcctgccg
gcggactacaccggcgagcagttgctgcagttcgccctgtgccagaaccgcgtggtcagt
ctcgtcgacctgccgtcgcggctgcacgagaccggcttcctgccggcaggggagcagccc
tggctgtccctgctctgcgttccgctggtgagcccggagaaaacggtcgagggcatggtg
gtctgcgccacccggcgcccactggacctgcagggattcgcccatccactgggccagttg
ggctcgttcgtgctggcccagctgcatctgctgcaacgcctctcgcaaccctccggcgag
ccgcagggaccgtccagcgcgccggtggtcagcggctacgggctgatcggcaggagcgcg
gcgatgcgtgagacctgccgcctgatcagcaaggtcctgcacaacccctataccgtgttg
ctgcagggcgagaccggcaccggcaaggaggtggtcgcacgggcgatccacgagtacggc
ccgcggcgagcacaggcgttcgtggtgcagaactgcgcggcgtttccggaaaacctgctg
gaaagcgagctgttcggctaccgcaagggcgcctttaccggtgccgagcgcgatcgtccc
gggttgttcgatgccgcggatggcggaaccctgctgctcgacgaaatcggcgacatgccc
ctgtcgctccaggccaagctgttgcgcgtgttgcaggaaggcgagattcgcccgctcggc
ggcaacgacacgcacaaggtcgatgtacgcatcatcgccgctacccaccgtgacctcgcc
ctgctggtccgcgatggcaagttccgcgaagacctctactaccggctggcgcagtttccc
atcgagttgtcgccgttgcgccagcgcgagggcgacgccctcgaactggcccggcatttc
gccgaacgcgcctgcgtgttcctgcgccgcgcgccgctgggctggtccgcggaagcgctg
gaactgctcgacggctatggctttcccggcaacgttcgggagctgaagggactggtggaa
tgcgcggtactgctctgcgaaggcgatgtgctgctggccgaacacttttccctgcgcgcg
cccccggaagcggaggcgccgctcaagctgcgcgagcacctggagcagatcgagcgcgac
ctgctgctcgcctgcctgcgcaggaacgctggcaaccagaccctcgctgcgcgcgaactg
ggtctgccgcgccgaaccctgatctatcgcatgggacgcctgaacattcatttcggcgat
ccccggacctga

DBGET integrated database retrieval system