KEGG   Pseudomonas aeruginosa B136-33: G655_16925
Entry
G655_16925        CDS       T02627                                 

Definition
(GenBank) Rhs family protein
Organism
psg  Pseudomonas aeruginosa B136-33
SSDB
Motif
Pfam: RHS_repeat RHS MerR FdhE OCRE
Other DBs
NCBI-ProteinID: AGI82301
Position
3733037..3737881
AA seq 1614 aa
MISSFYAMFMLRGVNAKQPDASQLIGEFSSGVLNRYEEYANSWLWGWALDVQQTIALSDG
NGNELTRLKADKDANILEDVASCPVNGQLKLLHTFESTSFVPIGNTPYEITRIGSRTPQF
KGVLDADGMASISGCAPNTLYQVKFYPEVSIQEIDALYRSYDDVIAKLNEWLLEQWNGPL
SAEWKRLAPVGDRRRMEQINDAYLDGMGKALVNLWDDVVELFGILANLDEHAAKLLEFIN
EADFEKLKAQAKELLGTALLIASDEPLLFIYASAIVCWTQLLPPTTAAEMVAELSTGLLL
DILLGIILTGGAGLAVRLAVKGSKAIKASEGAMLLRKAMQVLFDTSCRHSLQLHAEKLKP
LAVRGEVMANSSNKITAQIQSTAQGIARTEPDTLPLSRGKRANTSLSSSQATPDASAPGR
TPAGKPADQAAQTCVKDCPVSMVTGEELLTLTDCELDGPLRFAWTRLYRTSAAEIDNGLG
FGWSHALSHRLDRDGDELVWTDHENRRTRFPIPDAQRPAITNRLSRAAIYLGGDPSELIL
AQAGEKPRFYHFRKDPDGAYLIAISDAYGNRLELSRDRLGRPRRLSHKAGRALLLCYQGR
HIERVEYQVYQPADNLEACWHTTQVLARYRCNERGQLIEAGNALYEAERYRYDARNVILE
RQLAGGASFFWEWEGEGKQARAVHHWASFPQMDSRYVWNEDGSVTAINADGSEEVYVHDD
NARLVRQVDPDGGETLRHYDEKGQLVAERDPLGTITEYRYDQAGRLEALLPAEGEPTCYS
YFDGLVRSVRRGEAQWKYERNAQGDITRQTDPEGNVTHYAYDHRGCLVEITHADGSLHQL
TWNPLGQLIEEQLPDGSVRRYRYDTLGRQITRQDESGAITRFQWDAAGRLSQITLPGGAS
RMYRYNAYGKVTSECDEQGRMTRYEYLDDLHLVSRRINPDGSQLRYRYENARLLLSEIEN
ERGERYRLDYHGNGLISQETGFDGRRTAYRYDLKGQLLEKTEYGDDGSELRTTYQRDSTG
RLLAKTLPDGNRVDYRYDTLGRLVAVDDGTWPLAYEYDLRDRLVREHQGWATLHYAYDAL
GQLIHCRLPDGNRVDYRYQTGGTLSAIDLNGQSLTRHQFGSGRERQRQQGELLSQYHYDE
QGRLLAHQVSQRQRHLYQRQYRYDASGNLAAIEDSRKGIRSFHYDPLDRLLGVRGETPES
FVHDPAGNLLAQGGQFDARQMEVRGNRLLTQGDRHFDYDAHGNLVRERRGTGQKLVTEYS
YDCQHRLIGVSLPDGRQVAYRYDAFGRRIAKQVDGRNTEFLWLGERLLAESGDRHYRTYL
YEPDSFRPLALLDGEGPEQVEPCYYQLDHLGTPQELTRADGRLCWSARYRAYGNVLKLDI
AEVDNPLRFQGQYFDAETGLHYNRHRYYNPSTGRYLTPDPIRLAGGLNSYRYVPNPTGWV
DPLGLASNKTRCPEALDNNPRKGINSTSGSKKPAGPIVELDAQGNEIYYRTLSEQHLEIL
RNNFEVPPTSETFISPLQSYSQEYDGKLVRLTASPGTMNELSKIGVTANSGTGLLLPDLP
PARKGWKQNNALFKLEALKKLTINEGGGVINTGLGDGKALEIFNKNLIDFEVID
NT seq 4845 nt   +upstreamnt  +downstreamnt
atgatctcgtcgttctacgccatgttcatgctgcgcggagtgaacgcgaagcagccggat
gccagccagttgatcggcgaattcagctccggggtgctcaaccgctatgaggaatatgcg
aacagttggctctggggctgggcactcgacgtccagcagaccatcgccctttccgatggg
aacggcaacgagttgaccaggctgaaagccgacaaggacgccaacatcctcgaagacgtc
gcctcatgtccggtcaacggtcaactgaaactgctgcatactttcgaatcgaccagtttc
gtgcccatcggcaacacgccttacgaaatcactcggataggcagcaggacaccgcagttc
aagggcgtactggatgcagatgggatggcgagcataagcggctgcgctcccaatacgctg
taccaggtcaagttctacccagaggtaagcatccaggagatcgacgcgctctaccgctcc
tacgacgacgtaatcgccaagctgaacgaatggcttctggagcaatggaacggcccgctt
tccgccgaatggaaaaggctcgcgccggttggcgaccgtaggcggatggagcagataaac
gacgcctatctggacggcatgggcaaagcgctggtcaatctctgggatgatgtggtcgag
ctgttcggcatcctcgcgaacctcgacgagcacgcggcgaaactccttgagttcatcaac
gaagcggatttcgaaaagctcaaggctcaggccaaggaactcctcggtaccgccttgctg
atcgccagcgacgaaccgcttctgttcatctatgccagcgccatcgtgtgctggacccag
ttgctgccgcccacgactgccgcggaaatggtcgcggaactctccaccggcctgctcctc
gatattctgctcggcatcatcctgaccggcggagccggtctcgccgttcgcctggccgtc
aagggctcgaaagcgatcaaggcctccgaaggtgcgatgctgctgcgcaaagccatgcag
gtgctgttcgataccagttgtcggcattccctccagttgcacgcggaaaagctgaaacct
ctggccgtccgcggtgaagtgatggccaacagctccaacaagatcaccgcacagatccag
agcaccgcccaaggcatcgcccgcaccgagcccgacaccctgccgctgagccgaggaaag
cgcgcgaacacctcgctctccagcagtcaggcgacgcccgatgcctccgcacccggcagg
acgcccgccggcaaacccgccgaccaggccgcccagacctgcgtcaaggactgtcccgtt
tcgatggtcaccggcgaggagctgctgaccctgaccgactgcgagctagacggtccgctg
cgtttcgcctggacgcgcctgtaccgcaccagcgcggcggaaatcgacaatggtctgggc
ttcggctggagccatgccctctcccatcgcctcgatcgcgacggcgacgagctggtatgg
accgatcacgagaaccgccggacccgcttcccgatccctgacgcccagcgcccggcgatc
accaaccgactgtcgcgcgccgccatctacctcggcggcgacccatccgaactgatcctt
gcccaggccggcgaaaagccgcgcttctaccacttccgcaaagacccggacggcgcttac
ctgatcgccatcagcgacgcctacggcaaccgcctggaactgagtcgcgaccgcctcggc
cggccgcgccgcctcagccacaaggccgggcgcgcgctactgctgtgctaccagggcagg
cacatcgagcgcgtcgagtaccaggtgtaccagcccgccgataacctggaggcctgctgg
cacaccacccaggtactcgcccgctaccgctgcaacgaacgtggccagttgatcgaagcc
ggaaacgcactctacgaggccgaacgctatcgctacgacgcgcgcaatgtcatcctcgag
cgccagttggccggcggcgcctcgttcttctgggaatgggaaggcgaaggcaagcaggcc
cgcgcggtccatcactgggccagcttcccgcagatggactcgcgctacgtctggaacgaa
gacggcagcgttaccgcgatcaacgccgacggcagcgaggaagtctatgtccacgacgac
aacgcgcgcctggtacgccaggtcgatcccgacggaggcgaaaccctcaggcactacgac
gagaagggccaactggtcgccgaacgcgatccgttgggaacgatcaccgagtaccgctac
gaccaggccggacgcttggaggcactgctcccggccgaaggcgagccaacctgctatagc
tacttcgacggcctcgtgcgcagcgtgcgccgcggcgaggcgcagtggaagtacgagcgc
aacgctcagggcgacatcacccgccagaccgatcccgaaggcaacgtcacccactacgcc
tacgaccaccgcggctgcctggtggaaatcacccatgccgacggcagcctgcaccagttg
acctggaatccgctcggccagttgatagaagaacagcttccggacggtagcgtgcgccgc
tatcgctacgacacactgggtagacagatcacccgccaggacgaaagcggcgccatcacc
cggttccagtgggatgcagcaggccgcctgagccagatcaccctgcccggtggcgccagc
cgcatgtaccgctacaacgcttacggcaaggtcaccagcgagtgcgacgaacagggccgg
atgacccgctacgaatatcttgacgacctgcacctggtcagccggcggatcaacccggac
ggcagtcagctgcgctaccgctacgaaaacgcccggctactgctcagcgagatcgagaac
gaacgcggcgaacgctatcgcctcgattaccacggcaacggcctgatcagccaggaaacc
ggcttcgacggccgccgcaccgcctatcgctacgacctcaaaggccagcttctggagaaa
accgagtacggcgacgacggcagcgaactgcgcaccacctaccagcgcgacagtaccggg
cgcctgctggcgaagacactgcccgacggcaatcgggtcgactaccgctacgatacgctc
ggacgcctggtcgccgtcgacgacggcacctggccgctggcctacgaatacgacctacgg
gaccgcctggtccgcgagcaccagggctgggccacccttcactacgcctacgacgccctc
ggccagttgatccactgccgactgcccgacggcaaccgcgtcgactaccgctaccagacc
ggcggcaccctctcggcaatcgatctcaacggccagtccctgacccggcaccagttcggt
agcggtcgcgaacgccagcgccagcagggcgaactgctcagccaataccactacgatgag
cagggccgcctgctggcccaccaggtcagtcagcggcagcgccatctctaccagcgccag
taccgctatgacgctagcggcaacctggccgccatcgaggacagccgcaagggcattcgc
agcttccactacgacccgctggaccgcctgctcggcgtacgcggtgaaaccccggaaagc
ttcgtgcacgacccggccggcaacctgctcgcccagggcgggcaattcgacgcgcgacag
atggaggttcgcggaaatcgcctgctgacgcagggcgaccggcatttcgactacgacgcc
cacggcaatctcgttcgcgaacgccgcggcaccgggcagaagctggtcaccgaatacagc
tacgactgccaacaccgcctgatcggcgtcagcctgccggacgggcgccaggtcgcctac
cgctacgacgccttcggccgacgcatcgccaagcaggtcgacgggcgcaataccgagttc
ctctggctcggcgaacgcctgctcgccgagagcggcgaccggcactaccgcacctatctc
tacgaacccgacagctttcgcccgctggccctgctcgacggcgaaggcccggaacaggtc
gaaccctgctactaccaactcgaccacctcggtaccccgcaggaactgacccgcgccgat
ggccgcctctgctggtcggcgcgctaccgggcttacggcaatgtgctcaagctggacatc
gccgaagtggataacccactgcgcttccagggccagtatttcgacgccgagaccgggctg
cactacaaccgccatcgctactacaatccaagcacgggacgctacctgacccccgatccg
atcaggctggcaggtgggttgaacagctaccggtacgtgccgaatccgacggggtgggtg
gacccgttggggctggcctcaaataaaactcgctgtcccgaagcattagacaataatccc
cgcaaagggattaactccacatccggcagcaaaaagccggcaggaccaatcgtagagttg
gatgcgcagggaaacgagatttactaccgaacactaagcgagcagcaccttgagatactg
aggaacaactttgaagtacctccgacgagtgagaccttcatctccccgctacaatcctac
tcccaagagtatgatgggaaattagtaagacttacagccagtccaggcaccatgaatgag
ctgtctaaaattggagtaactgcaaattccggaaccggcctattgcttccagatctccct
cccgcccgaaagggctggaaacagaacaacgcactattcaaactcgaagcactaaaaaag
ctaacgataaatgaaggaggcggcgttatcaacactggccttggggatggaaaagcccta
gagattttcaacaagaacctaatagacttcgaagtaatagactag

DBGET integrated database retrieval system