KEGG   Pseudomonas aeruginosa B136-33: G655_18905Help
Entry
G655_18905        CDS       T02627                                 

Definition
(GenBank) semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00040  Pentose and glucuronate interconversions
psg00053  Ascorbate and aldarate metabolism
psg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    G655_18905
   00053 Ascorbate and aldarate metabolism
    G655_18905
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     G655_18905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGI82697
Position
4164891..4166471
Genome map
AA seq 526 aa AA seqDB search
MPSILGHNYVGGARRAAGNLILRSLDADSGEALPYAFVQATEAEVDAAARAAERAYPHYR
QLSATRRAGFLEAIASRLDALGDDFVALVRRETALPAVRIQGERTRTANQLRLFAEVLRR
GDFHGARIDRGQPGRTPPRPDLRQWRIGLGPVAVFGASNFPLAFSTAGGDSAAALAAGCP
VVVKAHGGHMATAECVADAILQAAADSGMPAGVFNMVYGSGIGETLVRHPAIRAVGFTGS
LKGGRALCDLAAARPQPIPVFAEMSSINPLVVLPEALRRRGRQVAEELAASVTLGCGQFC
TKPGLVLGLRSPGFDAFVAALGEALAARPAQSMLNAGTLRSYVEGLQRLERHPGIRRLAG
APQEGRQAHPQLFKADVGLLLEGDELLQEEVFGPATVVVEAADEEQLARALDNLHGQLTA
TLIGEADDLAAFAGLVPLLEGKAGRLLFNGYPTGVEVCDAMVHGGPYPATSDARGTSVGT
LAIERFLRPLCYQDYPDSLLPDALKNANPLGLLRLVDGRSTREALD
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcccagtatcctcggtcacaactacgtcggcggcgctcgccgcgccgccggcaacctc
atcctgcgcagcctcgacgccgacagcggcgaagcgctgccctacgccttcgtccaggcc
accgaggcggaggtcgacgccgccgcccgcgccgccgaacgcgcctatccacactaccgg
caactgtccgccacgcgccgcgccggattcctcgaggcgatcgcctcgcgcctcgacgcc
ctgggcgacgacttcgtcgccctggtccgtcgcgagaccgcgctgcccgccgtacgcatc
cagggcgaacggacacgtaccgccaaccagttgcggctgttcgccgaagtcctgcggcgt
ggcgacttccacggcgcgcgcatcgatcgcggacaacccgggcgtaccccgccgcgcccc
gacctgcgccagtggcgaatcggtctcggcccggtggcggtgttcggtgccagcaacttc
ccgctggccttttccaccgccggcggcgacagcgccgccgccctggccgccggctgtccg
gtggtggtcaaggcccacggcggacacatggccacagccgaatgcgtggccgacgcgatc
ctccaggcggcggccgacagcggcatgccggccggggtattcaacatggtctacggcagc
ggcatcggcgagacgctggtgcgccatccggccatccgcgcggtcggcttcaccggttcg
ctcaagggcgggcgcgcactgtgcgacctggcagcggcgcggccgcagccgatcccggtg
ttcgccgagatgagcagcatcaatccgctggtggtgctccccgaagccctgcgccggcgc
ggccggcaggtggcggaggagctggccgcctcggtgacgctcggctgcggccagttctgc
accaagccgggtctggtgcttggcctgcgctcccccggcttcgacgccttcgtcgcggcc
ctgggcgaggcactggccgccaggccggcacagagcatgctcaacgccggcaccttgcgc
agctatgtcgaagggctgcaacgcctggagcgccaccccggcatccggcgcctggccggc
gcgccacaggaaggacggcaggcccatccgcagttgttcaaggccgacgtgggcctgttg
ctggaaggcgacgaactgctccaggaagaggtgttcggcccggccaccgtggtcgtcgag
gcggccgacgaggaacaacttgcccgcgcgctggacaacctgcacggccagttgacggcg
accctgatcggcgaagcggacgacctcgcggcgttcgccgggctggtcccgctgctcgaa
ggcaaggccgggcgcctgctattcaacggctatccgaccggcgtcgaggtgtgcgacgcc
atggtccacggcggcccctacccggccacctccgacgctcgcggcacctcggtgggaacc
ctggccatcgagcgtttcctgcgcccgctgtgctaccaggactaccccgacagcctgctc
ccggacgccctgaagaacgccaacccgctgggcctgctgcgcctggtcgatggccggagc
acgcgcgaggccctggattga

DBGET integrated database retrieval system