KEGG   Pseudomonas aeruginosa B136-33: G655_23115Help
Entry
G655_23115        CDS       T02627                                 

Definition
(GenBank) putative binding protein component of ABC transporter
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
psg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_23115
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    G655_23115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_23115
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    G655_23115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5 RGP
Motif
Other DBs
NCBI-ProteinID: AGI83537
Position
5074043..5075656
Genome map
AA seq 537 aa AA seqDB search
MRRNAVIRSAIIPSLLGAALVAAVPQAFASNLIFCSEGSPAGFDPAQYTTGTDFDAAAET
VFNRLTQFERGGTKVLPGLAESWDVSDDGKTYTFHLRKGVKFHSTDYFKPTREFNADDVL
FTFERMLDKDHPFRKAYPTEFPYFTDMGLDKNIARVEKLDEHTVKFTLNEVDAAFIQNLA
MPFPSIQSAEYAAQLLKQGKASDINQKPIGTGPFVFSRYQKDAQIRFKGNKDYWKPDEVK
VDNLIFAINTDASVRAQKLKAGECQITLNPRPADLDALKKDPNLNLPSQAGFNLGYIAYN
VTHKPFDKLEVRQALDMAVNKKAIIDAVYQGAGQLASNGMPPTQWSYDETIKDAPYDPAK
ARELLKKSGVAEGTEITLWAMPVQRPYNPNAKLMAEMLQNDWAKIGIKAKIVTYEWGEYI
KRAKGGEHDAMLIGWSGDNGDPDNWLGTLYGCDAVDGNNFSKWCDAGYDKLVKDAKRTTD
QGKRTELYKQAQHILKEQVPITPIAHSTVYQPMRKTVHDFRISPFGLNSFYEVSVGK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagaaacgccgtcatccgctccgcgatcattccctcgctgctcggcgcagcgctg
gtcgccgccgttccccaggccttcgccagcaacctgatcttctgctcggaaggcagcccg
gccggcttcgatcccgcccagtacaccaccggtaccgatttcgacgccgcggcggaaacc
gtcttcaaccgcctgacccagttcgagcgcggcggcaccaaggtccttcccggcctcgcg
gaaagctgggacgtcagcgacgacggcaagacctataccttccacctgcgcaagggcgtg
aagttccacagtaccgactacttcaagccgacccgcgaattcaatgccgacgacgtgctg
ttcaccttcgaacgcatgctcgacaaggatcatccgttccgcaaggcctaccccaccgag
tttccctacttcaccgacatgggcctggacaagaacatcgccagggtcgagaagctcgac
gagcatacggtgaagttcaccctcaacgaggtcgacgcggccttcatccagaacctggcg
atgcccttcccatcgatccagtccgccgaatacgccgcgcaactgctcaagcagggcaag
gccagcgacatcaaccagaagccgatcggcaccggcccgttcgtgttcagccgctaccag
aaggatgcgcagatccgcttcaagggcaacaaggactactggaagccggacgaggtgaag
gtcgacaacctgatcttcgccatcaacaccgacgcctcggtgcgcgcgcagaagctcaag
gccggcgagtgccagatcaccctcaacccgcgccccgccgacctcgacgcgctgaagaag
gacccgaacctgaacctgccgtcgcaggccggcttcaacctcggctacatcgcctacaac
gtcacccacaagccgttcgacaagctggaagtacgccaggcgctggacatggcggtgaac
aagaaggccatcatcgacgccgtctaccagggcgccggccagttggcgagcaacggcatg
ccaccgacccagtggtcctacgacgagaccatcaaggacgcgccctacgatccggccaag
gccagggagctgctgaagaagtccggggtcgccgaaggcaccgagatcaccctgtgggcc
atgccggtacaacgcccctacaaccccaacgccaagctgatggcggaaatgctgcagaac
gattgggcgaagatcggtatcaaggcgaagatcgtcacctacgaatggggcgaatacatc
aagcgcgccaagggcggcgagcatgacgccatgctgatcggctggagcggcgacaacggc
gacccggacaactggctcggcaccctctacggctgcgacgcggtggacggcaacaacttc
tccaaatggtgcgacgccggctacgacaagctggtcaaggatgccaagcgcaccaccgac
cagggcaagcgcaccgagctgtacaagcaggcccagcacatcctcaaggaacaagtgccg
atcaccccgatcgcccactccaccgtgtaccagccgatgcgcaagacggtacacgacttc
aggatcagtcccttcggcctgaactcgttctacgaggtcagcgtcggcaagtag

KEGG   Pseudomonas aeruginosa B136-33: G655_23120Help
Entry
G655_23120        CDS       T02627                                 

Definition
(GenBank) ABC transporter binding protein
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
psg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_23120
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    G655_23120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_23120
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    G655_23120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGI83538
Position
5075750..5077348
Genome map
AA seq 532 aa AA seqDB search
MRPRSALRYSLLLLAFAASAAIQAQPKTLAVCTEAAPEGFDPARYTSGYTFDASAHPLYN
ALAAFAPGSATVIPALAESWDVSADGLVYTFRLRQGVKFHSTEYFKPSREFNADDVLFSF
QRMLDPQHPAHDLSPSGYPYADAMQLRDIIERIEKIDEHQVRFVLKHPEAPFLADLAMPF
GSILSAEYAGQLIARDKGDELNSKPIGTGPFVFTRYRKDAQVRYAANPDYWKGKPAIDHL
VLAITLDPNVRVQRLRRNECQIALTPKPEDVAALRQDPQLTVLEEAAMITSHAAINTRHE
PFDDPRVRRAIAMGFNKSSYLKIVFGDQARPAIGPYPPMLLGYDDSIRDWPYDPERAKAL
LKEAGVAPDTPLNLYISTGSGPGGNPARVAQLIQSDLAAIGIRVNIRQFEWGEMVKRTKA
GEHDMMLYNWIGDNGDPDNFLTHNPGCASVESGENRARWCDKGFDEAIRKARMSNDESQR
VALYKEAQRIFHEQMPWLPLAHPLMFDAQRKNVSGYRMSPMSARDFSRVKLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccacgctctgccctgcgctacagcctgctgctactcgccttcgccgccagcgcc
gccatccaggcccagccgaagaccctggcggtgtgcaccgaagcggcgccggaagggttc
gatccggcccgctatacctccggctacaccttcgacgcctcagcccatccgctgtacaac
gcgctggccgcgttcgctccgggcagcgccacggtgatcccggccctggcggaaagctgg
gacgtctccgctgacggcctcgtctacaccttccgcctgcgccagggcgtgaaattccac
agcaccgagtacttcaagccaagccgcgaattcaacgccgacgacgtgctgttcagcttc
cagcgcatgctcgatccgcagcaccccgcccacgacctttcgcccagcggctacccctac
gccgacgccatgcaactgcgcgacatcatcgagcgcatcgagaagatcgacgagcaccag
gtgcgcttcgtcctcaagcacccggaggcgccgttcctcgccgacctggccatgccgttc
ggctcgatcctctccgccgaatatgccggccaactgatcgccagggacaagggcgacgaa
ctcaacagcaagccgatcggcaccggcccgttcgtcttcacccgctaccgcaaggatgcc
caggtgcgctacgcggccaaccccgactactggaagggcaagccggccatcgaccacctg
gtgctggcgatcaccctcgatcccaacgtgcgcgtgcagcgcctgcgtcgcaacgaatgc
cagatcgccctgacgcccaagccggaagacgtcgccgcgttgcgccaggacccgcaactg
acggtgctggaagaagcggcgatgatcacctcacacgccgcgatcaacacccggcacgaa
ccgttcgacgacccgcgcgtgcgccgggcgatcgccatgggcttcaacaagtcgtcctac
ctgaagatcgtcttcggcgaccaggcccgcccggccatcggcccctacccgccgatgctg
ctcggctacgacgacagcatccgcgactggccctacgaccccgaacgggccaaggccctg
ctgaaggaagccggcgtcgccccggacacacccctgaacctctacatcagcactggcagc
ggccccggcggcaacccggcgcgagtggcgcaactgatccagtccgacctggccgccatc
ggcatccgggtgaacatccgccagttcgagtggggcgagatggtcaagcgcaccaaggcc
ggcgaacacgacatgatgctctacaactggatcggcgataacggcgacccggacaacttc
ctcacccacaaccccggctgcgcctcggtggagtccggggaaaatcgcgcgcgctggtgc
gacaagggcttcgacgaagccatccgcaaggcgcgcatgagcaacgacgagagccaacgg
gtagcgttgtacaaggaagcgcagcggatcttccacgagcagatgccctggttgccgctg
gcgcatccgttgatgttcgacgcacaacgcaagaacgtcagcggctaccgcatgagcccg
atgtcggcgcgggacttttcgcgggtgaagctggactga

KEGG   Pseudomonas aeruginosa B136-33: G655_23135Help
Entry
G655_23135        CDS       T02627                                 

Definition
(GenBank) ABC transporter binding protein
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
psg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_23135
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    G655_23135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_23135
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    G655_23135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGI83541
Position
5079631..5081232
Genome map
AA seq 533 aa AA seqDB search
MRKILPLRAWLAAGLILGSPFSHAASNLVFCSEGSPAGFDPAQYTTGTDYDATSVTLFNR
LVQFERGGTRAIPALAESWDIGDDGKTYTFHLRKGVKFHSTDYFKPTREFNADDVLFTFQ
RMLDKNHPFRKAYPTEFPYFTDMGLDKNIARVEKLDEHRVKFTLNEVDAAFIQNLAMDVA
SIQSAEYAGQLLEAGKPQQINQKPIGTGPFILSRYQKDAQIRFKGNKDYWKPEDVKIDNL
IFSINTDAAVRAQKLKAGECQITLNPRPADLKALQEAANLKVPSQPGFNLGYIAYNVTHK
PFDQLEVRQALDMAVNKQAIIDAVYQGAGQLAVNGMPPTQWSYDETIKDAPFDPAKAREL
LKKAGVAEGTEITLWAMPVQRPYNPNAKLMAEMIQADWAKIGIKARIVSYEWGEYIKRAH
AGEHDAMLFGWTGDNGDPDNWLATLYGCDSINGNNVSKWCDAAYDKLVKAAKRVSDQDKR
SELYKQAQHILKEQVPITPIAHSTVYQPMNKSVHDFKISPFSRNAFYGVTNQP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagatccttccccttcgggcctggctggcagccggtctgatcctcggctccccg
ttctcccacgccgccagcaacctggtgttctgctcggagggcagcccggccggcttcgac
cccgcccagtacaccaccggcaccgactacgacgcgacctcggtcaccctgttcaaccgc
ctcgtccagttcgagcgcggcggcacccgggcgatcccggccctggcggaaagctgggac
atcggcgacgacggcaagacctacaccttccacctgcgcaagggtgtgaagttccacagc
accgactacttcaagccgacccgcgaattcaatgccgacgacgtgctgttcaccttccag
cgcatgctcgacaagaatcatccgttccgcaaggcctaccccaccgagtttccctacttc
accgacatgggcctggacaagaacatcgccagggtcgagaagctcgacgagcacagggtg
aagttcaccctcaacgaggtcgacgcggccttcatccagaacctggcgatggacgtcgcc
tcgatccagtccgccgagtacgcagggcagttgctcgaggccggcaagccacagcagatc
aaccagaagccgatcggcaccgggcctttcatcctgagccgctaccagaaggatgcgcag
atccgcttcaagggcaacaaggactactggaaacccgaagacgtgaagatcgacaacctg
atcttctcgatcaacaccgacgccgcggtgcgcgcgcagaagctcaaggccggcgagtgc
cagatcaccctcaacccacgccccgccgatctcaaggccctgcaggaagcggcgaacctg
aaggtgccctcgcagccaggcttcaacctcggctacatcgcctacaacgtcacccacaag
ccgttcgaccagctcgaagtacgccaggcgctggacatggcggtgaacaagcaggccatc
atcgacgccgtctaccagggtgccgggcaactggcggtgaacggcatgccgccgacccag
tggtcctatgacgaaaccatcaaggacgccccgttcgatccggccaaggcccgggaactg
ctgaagaaggccggcgtcgccgagggcaccgagatcaccctgtgggcgatgccggtgcag
cgtccctacaaccccaacgccaagctgatggcggagatgatccaggccgactgggcgaag
atcggcatcaaggccaggatcgtcagctacgagtggggcgagtacatcaagcgcgcccat
gccggcgagcatgacgccatgctgttcggctggaccggcgacaacggcgatccggacaac
tggctggcgaccctctacggctgcgactcgatcaacggcaacaacgtatcgaaatggtgc
gacgcggcctacgacaagctggtcaaggctgccaagcgggtctccgaccaggacaagcgc
agcgagctgtacaagcaggcccagcacatcctcaaggagcaggtgccgatcaccccgatc
gcccactccaccgtgtaccagccgatgaacaagtcggtgcatgacttcaagatcagcccc
ttctcgcggaacgccttctatggcgtaaccaaccagccctga

KEGG   Pseudomonas aeruginosa B136-33: G655_23145Help
Entry
G655_23145        CDS       T02627                                 

Definition
(GenBank) binding protein component of ABC transporter
  KO
K12368  dipeptide transport system substrate-binding protein
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg02010  ABC transporters
psg02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G655_23145
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    G655_23145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psg02000]
    G655_23145
Transporters [BR:psg02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    G655_23145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: AGI83543
Position
5082961..5084556
Genome map
AA seq 531 aa AA seqDB search
MLHPLLRHLPLALALCAAGAAQAKNLVVCTEASPEGFDIVQYTGAVTADASAETVFNRLL
AFRPGTTEVIPGLAERWDVSADGLSYTFHLRPGVKFHTTDYFKPTRSLNADDVLWTFQRA
LDPKHPWHASALRGYAYFDAMGMGELIKSVEKVDELTVRFVLNRPEAPFLRDMAMPFASI
YSAEYGDQLLAAGKQGQLNNQPIGTGPFVFKRYAKDAQVRYTANPDYYAGKPPIDNLVFA
ITLDPNVRMQKVRAGECQVSLYPKPEDVPRLKQDPNLAVDEIDALLTTYIAINTQHKPLD
DPRVRQAINLALDKKAMLDAVFGPGAASPAVGPYPPTLLGYNHSIQDWPHDPERARALLK
EAGAENLRITLFIRNGTSPTIPNPALAAQMLQADLAKAGIHLTIRSLEWGELLKRSKAGE
HDLSLLGWAGDNGDPDNFLSPNLSCAAAESGENQARWCDKDFEALMRKAREVSDPAERAK
LYEQGQVVFHEQAPWIPLAYPKLFNVRRNTVQGYVINPLSNNNFATTSVKP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctccatccgttgctccgacacctgcccctggccctggcgctatgcgccgccggcgcg
gcccaggcgaagaacctggtggtctgcaccgaggccagcccggaaggcttcgacatcgtc
cagtacaccggcgcggtgaccgccgacgcctccgcggaaaccgtgttcaaccgcctgctc
gccttccgccccggcaccaccgaggtgatcccggggctggccgagcgctgggacgtcagc
gccgacggactgagctataccttccacctgcgccccggcgtgaaattccataccaccgac
tacttcaagccgacccggagcctgaatgccgatgatgtgctgtggaccttccagcgcgcc
ctcgatccgaagcatccctggcatgcctcggcgctgcgcggctacgcctacttcgacgcg
atgggcatgggcgagctgatcaagtcggtggaaaaggtcgacgagctcaccgtgcgcttc
gtcctcaaccgtcccgaagcgccgttcctgcgcgatatggcgatgcccttcgcgtccatc
tattccgccgagtacggcgaccagttgctcgccgccggcaagcagggccagttgaacaac
cagccgatcggcaccgggccgttcgtcttcaagcgctacgccaaggacgcccaggtccgc
tacacggcgaacccggactactacgccggcaagccgccgatcgacaatctggtgttcgcc
attaccctcgatcccaacgtgcgcatgcagaaggtccgtgccggcgagtgccaggtctcg
ctgtacccgaaaccggaggacgtgccgcgcctgaagcaggacccgaacctggcggtggac
gagatcgatgccctgctgaccacctacattgccatcaacacccagcacaagccgctcgac
gacccgcgcgtgcgccaggcgatcaacctcgctctggacaagaaggccatgctcgacgcg
gtgttcggccccggcgcggccagtccggctgtcggtccctatcccccgaccctgctcggc
tacaaccattcgatccaggactggccgcacgatcccgaacgcgccagggcgctgctcaag
gaagccggtgcggaaaatctcaggatcaccctgttcattcgcaacggcacctcgcctacc
atccccaatcctgccctggcagcacagatgctgcaagcagacctggccaaggccggcatc
catctgaccatccgttccctggaatggggcgagctgctcaagcgttcgaaggccggcgag
cacgacctgtcgctgcttggctgggccggcgacaacggcgacccggacaacttcctcagc
ccgaacctgagctgcgccgccgccgagtcgggtgaaaaccaggcgcgctggtgcgacaag
gacttcgaggcgctgatgcgcaaggcccgcgaggtgagcgatccggccgagcgggcgaaa
ctgtacgagcagggccaggtggtattccacgaacaggccccatggataccgctggcctac
ccgaagctgttcaacgtccggcggaacacggtgcagggctacgtgatcaatccgttgagc
aacaacaacttcgccaccacctcggtgaagccctag

DBGET integrated database retrieval system