KEGG   Pseudomonas aeruginosa B136-33: G655_24060Help
Entry
G655_24060        CDS       T02627                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00330  Arginine and proline metabolism
psg00332  Carbapenem biosynthesis
psg01100  Metabolic pathways
psg01130  Biosynthesis of antibiotics
psg01230  Biosynthesis of amino acids
Module
psg_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:psg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    G655_24060
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    G655_24060
Enzymes [BR:psg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     G655_24060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGI83724
Position
complement(5260553..5261671)
Genome map
AA seq 372 aa AA seqDB search
MRDKVTGARRWVVKIGSALLTADGRGLDRNAMAVWVEQMVALHCAGIELVLVSSGAVAAG
MSRLGWVSRPSAMHELQAAASVGQMGLVQAWESSFALHGLQTAQVLLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGG
RIERVLDRLRAGERLGTLLTPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSL
LPVGVKAVQGSFRRGEMVVCVDQGGREVARGLVNYSALEAQKILGQPTDAIEALLGYVDG
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgactggcgcgcggcgctgggtggtgaagatcggtagcgccctgctg
acggccgatggccgtgggctggatcgcaatgccatggccgtttgggtcgagcagatggtg
gcgctgcattgcgccggcatcgagctggtgctggtgtcgtccggcgccgtcgccgccggt
atgagccgcctgggctgggtgtcccgacctagcgcaatgcacgaactccaggccgccgcc
tcggtggggcagatggggttggtgcaggcctgggagtccagcttcgccctgcatggcctg
cagaccgcccaggtgttgctgacccatgacgacctttccgaccgcaagcgctacctgaac
gcccgcagcaccctgcggaccctggtcgagctgggcgtggtcccggtgatcaacgagaac
gatacggtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcactggtg
gccaacctggtcgaggccgacctgctggtgatccttaccgatcgcgacgggatgttcgac
gccgatccgcgcaacaatcccgatgcccaactgatctacgaggcgcgtgccgacgatccg
cagctcgatgcggtggccggcggcagtgccggcgccctggggcgcggcggaatgcagacc
aagctgcgggcggcgcgcctggcggcgcgttccggcgggcatacggtgatcgtcggtggg
cgtatcgagcgtgtcctcgaccgcctgcgcgccggcgaacgcctcggcaccctgttgact
cctgatcgcagtcgcaaggcggcgcgcaagcaatggctggccggccacttgcagatgcgc
ggcaccctggtgctggacgatggggcggtgaaggcggtgagccaggatcacaagagcctg
ttgccggttggggtcaaggcggtccagggcagcttccgtcgcggcgagatggtggtctgt
gtggaccagggcgggcgcgaagtggcgcgcggcctggtcaactacagtgcgctggaggcg
cagaagatcctcggtcagccgacggatgccatcgaggccttgctcggctacgtggatggg
ccggagctggtgcatcgcgacaatctggttctggtctga

DBGET integrated database retrieval system