KEGG   Pseudomonas aeruginosa B136-33: G655_26795
Entry
G655_26795        CDS       T02627                                 

Definition
(GenBank) hypothetical protein
Organism
psg  Pseudomonas aeruginosa B136-33
SSDB
Motif
Pfam: PLDc_2 PLDc DUF3375
Other DBs
NCBI-ProteinID: AGI84265
Position
complement(5881685..5883922)
AA seq 745 aa
MSDLYKPQTLKLYAQQAGSVRLTLDWFANKAFYPPRAGVHIKPLINGQAAFDAVHAAMEA
ARHSIDIITWGFDPAMRFKRPDGPRIGELLQTKGREGVQARVLVWSNQLARLKENTIPGA
GVGGSGGTWAGSGVASGSAVDNEVLRLEQRRQHNLNLIARQQEALERSERLHREGRLPSF
DPRGAAHARTRIAELEAENAEIQRTLDSSGAQGYGGKRGSGGTRQDPWGQIFTRDWFKAV
RGGGLQNVEFRTRDFEQTARPVMNGEQVRLVNGRLQSLIHLLRADGIDDLGIGQLLVLTQ
FASHHQKMVLVDYGSPQAIGFVMGHNMHRNYWDTSAHLFDDRAAGRDPGFGPWQDISMQV
QGPVLADLSRNFSEAWDLETPWYKRWFSTPSLTAERDALPLPKIATPASNSVAQICRTQP
QDGERSILEHYLKALGNATDYVYMENQYFRYAGFAERLRKTAQVRKARGVPGDLYLFVVT
NTPDSSDASKTTYDMMKGLGQEQLMPQVQRDLAHDLREKREQLKQVRENLHPDPYVRRGQ
ENNIERLERKIEALEQKGVTPKVEQRLGGLGAQEIPGLAKNTGEDDKPYQLAEVPGLKVV
VATLATSDPAPGSPPPGRLSAEAEAALGAPPLKARYKHIYVHSKLLLVDDLYTLLSSANI
NVRSMHSDSELGIAQPNPDLARAMREELWGLHAYEVAATTKDNFELWNQTMDKNWKQQRN
DEPLTSHLLRFWDVITPYSPSFTVD
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgagcgacctgtacaaaccgcagaccctcaagctgtacgcgcaacaggccggcagcgtc
cggctgaccctcgactggttcgccaacaaggctttctacccgccgcgcgcgggtgtgcac
atcaagccgctgatcaatggccaggcggccttcgacgcggtgcatgcggcgatggaagcg
gcccggcacagcatcgacatcatcacctggggcttcgacccggccatgcgcttcaaacgc
cccgacggaccgcgaatcggcgaattgctgcagacgaagggccgcgaaggagtgcaggcg
cgagtgctggtctggagcaaccagctcgccaggctcaaggaaaacaccatccccggggcc
ggcgtcggcggttccggcggcacctgggcgggctcgggcgtcgccagcggcagcgcagtg
gacaacgaggtgctgcggctggagcagcggcgccagcataacctcaacctcatcgcgcgg
cagcaggaagccctggagcgctcggaacggctgcaccgcgaaggcaggctgccgagcttc
gacccgcggggcgccgcccacgcgcggacgcgcatcgccgagctggaggcggagaacgcc
gagatccagcgcactctcgacagcagcggggcccagggctacggcggcaagcgcggttcc
ggcggcacccgccaggatccctgggggcagatattcacccgcgactggttcaaggcggta
cgcggcggtgggttgcagaacgtcgagttccgtacccgcgacttcgagcagacggccaga
ccggtgatgaacggcgagcaagtgcgcctcgtcaatgggcggctgcaaagcctgatccac
ctgttgcgcgccgatggcatcgacgacctgggcatcggccagttgctggtactcacccag
ttcgccagccatcaccagaagatggtcctggtcgactatggcagcccgcaggccatcggc
ttcgtcatgggtcacaacatgcaccgcaactactgggacaccagcgcccacctgttcgac
gaccgcgccgccggtcgcgatcccgggttcgggccctggcaggatatctccatgcaagtc
cagggaccggtgctggccgacctcagccgcaacttcagcgaggcctgggacctcgagacg
ccgtggtacaagcgctggttctcgacgccatcgctgaccgccgagcgcgacgccttgccg
ctgccgaagatcgccacgcccgccagcaacagcgtcgcgcagatttgccgaacccagcca
caggacggcgagcgctcgatcctggagcactatctcaaggccctgggcaatgccaccgac
tacgtctacatggaaaaccagtacttccgttatgccggcttcgccgagcgcctgcggaag
actgcgcaggtgcgcaaggcccggggcgtgcccggcgacctgtacctgttcgtcgtgacc
aacacccccgactccagcgacgcctcgaagaccacctacgacatgatgaaaggcctgggc
caggagcaactgatgccgcaggtacagcgcgacctggcgcatgacttgcgggaaaagcgg
gagcagttgaagcaggtcagggaaaacctacatcccgatccctatgtccggcgcggccag
gaaaacaacatcgaacggctggagcgcaagatcgaagcgctcgaacagaaaggcgtgacg
ccgaaagtcgagcaacgcctcggcggtcttggcgcgcaggagattcccggactggcgaag
aacaccggcgaggacgacaagccctatcaactcgccgaagtacccggcctcaaggtggtc
gtcgccaccctggccaccagcgaccctgcccccggcagcccgccgccagggcgcctgtcc
gccgaagccgaggccgccctcggggcaccgccgctgaaggcgcgctacaagcacatctac
gtgcactccaagctgctgctggtggacgacctctataccctgctcagctcggccaatatc
aatgtccgcagcatgcatagcgacagcgagttggggattgcccagcccaatccggatttg
gcgagggcgatgcgggaggagttgtggggactacatgcgtatgaagtggctgcaacaacc
aaggacaactttgaactttggaatcaaacaatggacaagaactggaaacagcagcgaaac
gatgaacctctcactagccatctattacggttctgggatgtcataacaccttatagcccg
agctttacggtggattaa

DBGET integrated database retrieval system