KEGG   Pseudomonas aeruginosa B136-33: G655_28640Help
Entry
G655_28640        CDS       T02627                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
psg00020  Citrate cycle (TCA cycle)
psg00620  Pyruvate metabolism
psg00650  Butanoate metabolism
psg01100  Metabolic pathways
psg01110  Biosynthesis of secondary metabolites
psg01120  Microbial metabolism in diverse environments
psg01130  Biosynthesis of antibiotics
psg01200  Carbon metabolism
Module
psg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G655_28640
   00620 Pyruvate metabolism
    G655_28640
   00650 Butanoate metabolism
    G655_28640
Enzymes [BR:psg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     G655_28640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AGI84634
Structure
PDB: 

Position
6290210..6291703
Genome map
AA seq 497 aa AA seqDB search
MYRDRVRLPSLLDKVMSAAEAADLIQDGMTVGMSGFTRAGEAKAVPQALAMRAKERPLRI
SLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINAGEVMFIDQHLSETVEQLRNH
QLKLPDIAVIEAAAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLAHSTNLEGLHDIYI
PTYRPTRTPIPLTRVDDRIGSTAIPIPPEKIVAIVINDQPDSPSTVLPPDGETQAIANHL
IDFFKREVDAGRMSNSLGPLQAGIGSIANAVMCGLIESPFENLTMYSEVLQDSTFDLIDA
GKLRFASGSSITLSPRRNADVFGNLERYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVGGTKMMNGIGGSGDFARNAHLAIFVTKSIAKGGNISSVVPMVSHVDHTE
HDVDILVTEQGLADLRGLAPRERARVIIENCVHPSYQAPLLDYFEAACAKGGHTPHLLRE
ALAWHLNLEERGHMLAG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgcgtgcgcctgccctccctgctcgacaaggtgatgagtgcggccgaa
gccgccgacctgatccaggacggcatgaccgtcggcatgagcggtttcacccgcgccggc
gaggccaaggccgtaccccaggcgctggccatgcgcgccaaggaacgtccgctgcgtatc
agcctgatgaccggcgccagcctcggcaacgacctcgacaagcagctcaccgaggccggc
gtgctcgcccggcgcatgccgttccaggtcgacagcaccctgcgcaaggcgatcaacgcc
ggcgaagtgatgttcatcgaccagcacctctcggaaaccgtcgagcagttgcgcaaccac
cagctgaagctgccggacatcgccgtcatcgaagccgccgcgatcaccgagcagggccac
atcgtgccgaccacctcggtgggcaactcggcgagcttcgcgatcttcgccaagcaggtc
atcgtcgagatcaacctggcccacagcaccaatctggaaggcctgcacgacatctatatc
ccgacctaccggccgacccgcacgccgatcccgctgacccgcgtcgacgaccgcatcggc
agcacggcgatcccgatcccgccggagaagatcgtcgccatcgtcatcaacgaccagccg
gactcgccatccaccgtgctgccgccggacggcgagacccaggccatcgccaaccacctg
atcgatttcttcaagcgcgaggtcgacgccgggcgcatgagcaacagcctcggcccgctg
caggccggtatcggcagcatcgccaacgcggtgatgtgcggcctgatcgagtcgccgttc
gagaacctgaccatgtactccgaagtgctgcaggactcgaccttcgacctgatcgacgcc
ggcaagctgcgcttcgcctcgggcagctcgatcaccctgtcgccgcggcgcaacgccgac
gtgttcggtaacctggagcgctacaaggacaagctggtgctgcgcccgcaggaaatctcc
aaccaccccgaggtggtccgtcgcctgggcatcatcggcatcaatacggcgctggagttc
gacatctacggcaacgtcaactcgacccacgtcggcggcaccaagatgatgaacggcatc
ggcggctccggcgacttcgcccgcaacgcgcacctggcgatcttcgtcaccaagtcgatc
gccaagggcggcaacatttccagcgtggtgccgatggtcagccacgtcgaccacaccgag
cacgacgtcgacatcctcgtcaccgagcagggcctcgccgacctgcgcggcctggcgcct
cgcgaacgggcccgggtgatcatcgagaactgtgtccacccgtcctaccaggcaccgctg
ctggactacttcgaggcggcttgcgcgaaaggcggccacacgccgcatctgttgcgcgag
gcgctggcctggcacctgaacctggaagaacgtggacacatgctggccggctga

DBGET integrated database retrieval system