KEGG   Pseudomonas stutzeri RCH2: Psest_0126
Entry
Psest_0126        CDS       T02391                                 

Definition
(GenBank) type VI secretion protein, VC_A0111 family
  KO
K11895  type VI secretion system protein ImpH
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Psest_0126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_0126
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_0126
SSDB
Motif
Pfam: T6SS_TssG HalOD2
Other DBs
NCBI-ProteinID: AGA84739
UniProt: L0GHE5
Position
complement(124639..125646)
AA seq 335 aa
MDAAHGSATAALKPLNRGIREYSLFQGVLLVLDRLRQLNPGLDDEALYERLEFQANPSLG
FPGSDIEQVQFLQEHGEWRARLRINLVSLFGAGSPLPAFYGEQALGDSEDGNPTRDFLDL
FNNRLQRLLLPIWQKYRYRARFTSGAHDPFSEQLFALVGLSGEAIRNAPELNWKRLLPYL
GLLSLRAHSAALIESVLRYYFKHAELNIEQCLERQVEILGEQRNRLGQANSQLGESLVLG
ERVRDRGGKFRIHIRQLDWNRFHEFLPIGSGYQPLCALVRFTLRDPLDYDLRLELRPDEI
RELRIGADNNCRLGWTSWLGRERADGLVTLGSQTH
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggacgccgcgcatgggtcagcaaccgctgctctgaaaccgctcaaccgcggcatccgc
gagtacagcctgttccagggcgtgctgctggtgctcgatcgcctgcgccagctcaatccc
ggcctggacgacgaggcgctctacgagcgcctggagtttcaggccaacccgagcctgggc
tttcccggcagcgatatcgagcaggtgcagttcctccaggagcatggcgagtggcgcgcg
cgcctgcgcatcaacctggtcagcctgttcggcgccggatcgccgctgccagccttctat
ggcgaacaggcactgggcgacagcgaggacggcaacccgacccgcgactttctcgacctg
ttcaacaatcgcctgcagcgcctgctgctgccgatctggcagaagtaccgctaccgcgcc
cgcttcaccagcggcgcccatgaccccttctcggagcagctgttcgccctggtcgggctc
agcggcgaggcgatccgcaacgcgccggagctgaactggaagcgcctgctgccctatctc
ggcctactgagcttgcgcgcgcactcggcggcactgatcgaatcggtgctgcgctactac
ttcaagcacgccgagctgaacattgagcaatgtctggagcgccaggtggaaatcctcggc
gagcaacgcaaccgtctcggccaggccaacagccagctgggcgaaagcctggtgctcggc
gagcgggtccgcgaccgcggcggcaaattccgcatccatatccgccagctggactggaac
cgcttccacgaattcctccccatcggcagcggctaccagccgctctgtgcgctggtgcgc
ttcaccctgcgcgatccgctggattacgacctgcgcctggagcttcgcccggacgagatc
cgtgaactgcgcatcggcgccgacaacaactgccgcctcggctggaccagctggctcggg
cgtgaacgcgccgacggcctggtcaccctgggcagccagactcattaa

DBGET integrated database retrieval system