KEGG   Pseudomonas stutzeri RCH2: Psest_0131
Entry
Psest_0131        CDS       T02391                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
psh  Pseudomonas stutzeri RCH2
Brite
KEGG Orthology (KO) [BR:psh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_0131
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_0131
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AGA84744
UniProt: L0GHF0
Position
complement(130368..130775)
AA seq 135 aa
MNGYGSLFERLGGDAARRSGWSREVAAMASVAAHLAKMLSTRAGSVQTLPDYGLPDLNDM
RLSLHDSLQQARIAIERFIEAYEPRLTRVRVLSLPRTHDPLSLAFTIEGLLEVDGLKRQV
SFSASLDGSGQVKVQ
NT seq 408 nt   +upstreamnt  +downstreamnt
ttgaacggatacggcagccttttcgaacgcctcggcggcgacgccgcgcggcgttccggc
tggagccgcgaagtcgcggcaatggcctcggtggctgcccatctggccaagatgctcagc
acccgggcgggcagcgtgcagacgctgcccgactacgggttgcccgatctcaacgatatg
cgcctgtcgctgcacgactcgctgcagcaggcgcgtatcgccatcgaacgcttcatcgaa
gcgtacgaacccaggctgacccgggtgcgggtgctgtcactgccgcgaacccacgaccca
ctgagcctcgccttcaccattgaaggcctgctggaggtcgatggcctcaagcgccaggtc
agcttttccgccagcctggatggcagcggacaggtcaaggtccagtaa

DBGET integrated database retrieval system