KEGG   Pseudomonas stutzeri RCH2: Psest_0134
Entry
Psest_0134        CDS       T02391                                 

Definition
(GenBank) type VI secretion-associated protein, VC_A0119 family
  KO
K11910  type VI secretion system protein VasJ
Organism
psh  Pseudomonas stutzeri RCH2
Brite
KEGG Orthology (KO) [BR:psh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_0134
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_0134
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: AGA84747
UniProt: L0GG55
Position
complement(132808..134370)
AA seq 520 aa
MHASALSKHYLELARKPVNDSNFAGDDIRYSSEFELLETELAKAGALHQTTGIDWQKVRE
GSEMLLTSLSKDLRAAAWLTWSLFQRESFAGLQAGLSVLQYLCSNHWAELHPRKPRTRAA
AINWLLPRLEQTFSEDVPVGEQLPLFRGLAEQLHALEQCLSGHLGEDAPLLLPLCRQLDG
MVKRASQGQAQPGTVGAAIAQVKQVASQVFAPGSPIENDKEALKAVRNLQEQARPLTAWW
LKQRTSDLRPLRLSRTLLWLSIDSLPEHNGEQVTALRGIPADKLANYRERFAQGLYADLL
VDLENSTARAPFWLDGQRLAWECLQELAAEQAMREVEIQLALFLQRLPRLEELRFHDGIP
FADAETRAWISGQVMPHVQRAATTRQEEPPAAGSVQPSWELALQEALPLLRKEGLKPAVQ
QLKQGLARARGGRERFFWQLSLARLCYQAKKYELAKTQLEALDQQLEASGLGSWEPDLAL
EVLRLLHSCCELLPQNHAVRESKDEIYRRLCHLDLEVVLD
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgcacgccagcgcactcagcaagcattatctggaacttgccagaaaaccggtcaatgac
agcaatttcgctggcgacgatattcgctacagcagcgagttcgaactgctggaaaccgag
ctggcaaaggccggggcgctgcaccagaccaccggtatcgactggcagaaggtccgcgaa
ggcagcgagatgctgctcacctcgctgtccaaggacctgcgcgccgccgcctggctgacc
tggagcctgttccagcgtgaatccttcgccggtttgcaggccggtctaagcgttctgcag
tacctgtgcagcaatcactgggccgagctgcatccgcgcaagccacgcacccgtgccgcc
gcgatcaactggttgctgccgcgcctggagcagaccttttccgaagacgtccctgtcggc
gaacagctaccgctgttccgtggcctcgccgagcagctgcacgcactggaacaatgcctg
tccggccatctgggcgaagacgcaccgctgctgctgccgctgtgccgccaactcgacggc
atggtcaagcgcgccagtcaggggcaggcccagcccgggacggtcggcgcggctatcgcc
caggtgaagcaggtcgccagccaggtcttcgcccccggctcaccgatcgaaaatgacaag
gaagcgctcaaggcggtgcgcaacctgcaggaacaggcgcgcccgctgacggcctggtgg
ctcaagcagcgcaccagcgatctgcgcccgctgcgcctctcacgcaccctgctctggctg
agtatcgacagcctgccggagcacaacggcgagcaggtcaccgccctgcgtgggatacct
gccgacaagctggccaactaccgcgaacgcttcgcccagggtctgtacgcggacctgctg
gtggatctggagaacagcaccgcgcgtgccccgttctggctggacggccagcgcctggcc
tgggagtgcctgcaggagctggcggccgaacaggccatgcgcgaagtggagattcagctc
gcgctgttcctgcagcggctgccgcgcctggaggagctgcgctttcacgacggcatcccg
ttcgccgatgccgaaacccgcgcctggatcagcggccaggtcatgccccatgtgcagcgt
gccgccaccacaagacaggaagagccgcctgctgctggcagcgtgcagccgagctgggag
ctggcattgcaggaagcgctgccgctgttgcgcaaggaggggctcaaacctgccgtgcag
cagctcaagcagggcctggctcgcgcccgtggcggccgcgagcgcttcttctggcagctg
agcctcgcccgcctttgctaccaggcgaagaaatacgagctggccaaaacccagctcgaa
gcactcgaccagcagcttgaggccagcggcctgggcagctgggaacccgatctcgccctc
gaggtactgcgcctgctgcacagctgttgcgagctgctgccgcagaaccacgccgtgcgt
gaaagcaaggatgagatttaccgcaggctgtgccacctcgatctcgaagtggtgctggat
taa

DBGET integrated database retrieval system