KEGG   Pseudomonas stutzeri RCH2: Psest_0242Help
Entry
Psest_0242        CDS       T02391                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00430  Taurine and hypotaurine metabolism
psh00460  Cyanoamino acid metabolism
psh00480  Glutathione metabolism
psh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Psest_0242
   00460 Cyanoamino acid metabolism
    Psest_0242
   00480 Glutathione metabolism
    Psest_0242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:psh01002]
    Psest_0242
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Psest_0242
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Psest_0242
Peptidases and inhibitors [BR:psh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Psest_0242
CD molecules [BR:psh04090]
 Proteins
  Psest_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AGA84853
UniProt: L0GDM8
Position
complement(252880..254613)
Genome map
AA seq 577 aa AA seqDB search
MILRRPTLRKNLLKGFQGCLAALLLLACAAQGSALTNGAVATAHPLASEVGRHILESGGN
AFDATVAVSAALAVVEPYGAGLGGGGFFLLREADDPARHIFLDARERAPAAATPDMYLRD
GEIQRELSLNGPLAAAIPGIPAALVELAEKRGRLPLKTSLAPAIALARDGFAVDAVYRQR
ASWRLAALRNDPESARLFLHDGDLPAEGHLLRQAELADTLERLASQGRDGFYRGEVAERL
VQGVRAAGGIWTLQDLADYHTAEREPLRFALANGRELIGAPPPSAGGMILAQSLGILERL
AWRDAEPLQRSHLVVEALRRAYRDRGLLGDPDFVASPLPHLLSDQYLEQLASSIDPDRAT
PSIALPPAPRWREGEHTTHFAVIDAEGNAVAATLSLNMMFGAAFTVPGTGVLLNDEMDDF
AADIDGSNAYGLKGSSANAISGGKRPLSSMSPTFIESAEEFAAFGTPGGSRIPSMVLLSA
LSYLDGEPVQAWPAVPRYHHQYLPDVLQYEADAFTPTQLDALRERGHQPKLIERDYGNQQ
VLYWHKPSGTVEAASDPRGIGRALKVPAGREPVTAAE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcggcgaccgaccctgcggaaaaacctgctcaagggcttccagggttgtctc
gccgccctcctgctgctggcctgcgcggcccagggcagcgccctcaccaatggtgccgtg
gccacggcccatccgctggccagcgaagtcggccggcacattcttgaatcaggcggcaat
gcctttgacgccaccgttgcggtcagcgcggccctggcagtggtcgagccatacggggcc
gggctcggtggcggtggtttcttcctgctgcgcgaggccgacgacccggcccgccacatt
tttctcgatgcccgcgagcgcgcacccgctgctgccacgccggacatgtacctgcgcgat
ggcgagatccagcgcgagctctcgttgaacggcccgctggccgccgcgattcccggcatt
ccggcagcgctggtcgaactcgccgagaagcgcggccgcctgcccctgaagacctccctg
gcgccggccatcgccctggcccgcgatggctttgccgtggatgcggtctatcgccagcgc
gctagctggcgcctcgcggcgctgcgcaatgacccggagagcgcgcggctgtttctccac
gacggggacctgccagccgaaggccatctgctgcgccaggcggaactggccgacaccctg
gagcgcctcgccagccagggccgtgatggcttctaccgcggcgaggtggccgagcggttg
gtacaaggggtgcgagcagccggcggcatctggacactgcaggatctggccgactatcac
accgccgagcgcgagccgctgcgcttcgccctcgccaatggccgcgagctgatcggcgcg
ccgccgccctcggccggcggcatgatcctcgcgcagagcctcggcatcctcgaacgtctg
gcctggcgcgacgccgaaccgctgcaacgcagtcatctggtggtcgaggcgctgcgccgg
gcctatcgcgaccgcggcctgctgggcgatccggacttcgtcgcgtcaccgctgccacat
ctgctttcagaccagtaccttgagcagctcgccagctccatcgaccccgaccgggcgacg
cccagcatcgcgctgccgccagcgccgcgctggcgcgagggcgagcacactacgcatttc
gcggtgatcgatgccgaaggcaatgcggtggccgcgacgctgtcgctgaacatgatgttc
ggtgccgccttcaccgtgcccggcaccggcgtgctgctcaatgacgagatggacgatttc
gccgccgacatcgacggcagcaatgcctatggcctgaaaggcagcagtgccaacgccatc
tccggcggcaagcgtccgctgtcgagcatgagtccgaccttcatcgaaagcgccgaggag
ttcgccgccttcggcacgcccggcggcagccgcatcccgagcatggtgctgctttcggca
ctgtcttatctggatggcgagccggtgcaggcctggccggcggtgccgcgttatcaccac
caatacctgccggacgtactgcagtacgaggccgatgccttcaccccgactcagctcgat
gccctgcgcgagcgtggccaccagccgaaactgatcgagcgcgactacggcaaccagcag
gtcctctattggcacaagccgagcggcacggtcgaggcggccagcgacccacgcggcatc
ggccgagccctgaaagtgccggcaggccgcgaaccggttacagctgcagaatga

DBGET integrated database retrieval system