KEGG   Pseudomonas stutzeri RCH2: Psest_0357Help
Entry
Psest_0357        CDS       T02391                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00030  Pentose phosphate pathway
psh01100  Metabolic pathways
psh01120  Microbial metabolism in diverse environments
psh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psest_0357
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Psest_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd MCM2_N
Motif
Other DBs
NCBI-ProteinID: AGA84968
UniProt: L0GE23
Position
383075..383842
Genome map
AA seq 255 aa AA seqDB search
MRLQNQVALVTGSTQGIGRGIALRLAEEGADIVINGRQDDEQARESLEQVHARGRRVCFI
AADVGDVEQCQRLVREGIEQMGRLDILVNNAGVQRHAAFLDAQADDYDQVLNVNLRGPFF
LAQAFARYLREHGRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIELAPLGIT
VNNVAPGAVETPINRELMNQPEKLASLLQNIPAGRLGRPHDVAGVVAFLASPDAEYITGT
TLVVDGGLLWNYSEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcagaatcaggtggctctggtcaccggcagcacccagggcatcggccgcggc
atcgccttgcgcctggccgaggagggcgccgacatcgtcatcaacggccgccaggacgac
gagcaggcccgcgagagcctcgaacaggtacacgcccggggccggcgggtgtgcttcatc
gccgccgatgtcggtgacgtcgagcagtgccagcggttggtgcgcgaaggcatcgaacag
atggggcggctggatattctggtcaacaacgccggtgtgcagcggcacgcggcattcctc
gacgcgcaggcggatgattacgatcaggtgctgaacgtcaacctgcgtgggccgttcttt
cttgcccaggccttcgcccgttatctgcgcgagcatggccgcggcggacgcatcatcaac
aacagctcggtgcacgaagagctgccgcatcccaacttcaccgcctactgcgcgagcaag
ggcggactgaagatgctgatgcgcaacatcgccatcgaactggcgccgctgggcatcacg
gtgaacaacgtggcgcccggcgcggtggaaacgccgatcaatcgcgagctgatgaaccag
ccggaaaaattggccagcctgctgcagaacattccggccgggcgccttggccggccgcac
gacgtcgccggggtcgtcgcctttctggcctcaccggatgccgagtacatcaccgggacg
accctggtggtcgacggcggcctgctatggaactacagcgaacaatga

DBGET integrated database retrieval system