KEGG   Pseudomonas stutzeri RCH2: Psest_1428Help
Entry
Psest_1428        CDS       T02391                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Psest_1428
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Psest_1428
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Psest_1428
    1.1.1.-  
     Psest_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_N_assoc 2-Hacid_dh_C ADH_zinc_N_2 DAO
Motif
Other DBs
NCBI-ProteinID: AGA85982
UniProt: L0GJN9
Position
complement(1536853..1537941)
Genome map
AA seq 362 aa AA seqDB search
MNSQATMTAAVWHGRKDIRLEQVPLPGAPQPGWVQIRVHWCGICGSDLHEYLAGPVFIPV
DAPHPLTGIKGQCILGHEFCGEIVAIGEGVEGYAPGDKVAADACQHCGQCRFCKTGQYNL
CEQLAFTGLMNNGAFAEFVNVPAELLYRLPEGFPLEAGALIEPLAVGMHAVKKAGSLLGE
TVVVVGAGTIGLCTIMCAKAAGAGQVIALEMSAARKAKALEVGANWVIDPSECDAIAEIK
ALTGGYGAGVSFECIGHKATAKLAIDVIRKAGRCVMVGIFEEPSEFNFFEIVATEKQVIG
SLAYAGEFADVIALIDDGRIDVTPLITGRIGLDNILEQGFEELANHKDRNVKIIVSPGAL
AG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccaagccaccatgaccgccgccgtctggcacggtcgcaaggacatccgcctg
gaacaggtgccgctgcccggcgcgccgcaaccgggttgggtacagattcgcgtgcactgg
tgcggcatctgtggctccgacctgcacgaatacctcgccggcccggtgttcattccggtg
gacgcgccgcacccgctcaccggcatcaaaggccagtgcatcctcggccacgagttctgc
ggcgagatcgtcgccatcggtgaaggcgtcgagggctacgcgcctggcgacaaggtcgcc
gccgatgcctgccagcattgcgggcagtgccgtttctgcaagaccggccagtacaacctt
tgcgagcagctcgccttcaccggcctaatgaacaacggcgccttcgccgagttcgtcaac
gtgccggccgagttgctctaccgcttgcctgaaggatttccgctggaagccggcgcgctg
atcgagccgctggcagtcggcatgcacgcggtgaagaaggccggcagcctgctcggcgaa
accgtggtagtggtcggcgccggcaccattggcctgtgcaccatcatgtgcgccaaggcc
gctggcgccggccaggtgatcgccctggagatgtccgccgcacgcaaggccaaggcgctg
gaagtcggtgccaactgggtcatcgaccccagcgagtgcgacgccatcgccgaaatcaag
gcgctcaccggcggctacggtgccggcgtctccttcgagtgcatcggccacaaggccacc
gccaagctcgccatcgacgtgatccgcaaggctggtcgctgcgtgatggtgggcatcttc
gaggaaccctcggaattcaacttcttcgagatcgtcgccactgaaaaacaggtgatcggc
tcgctcgcctatgccggcgaattcgccgatgtcatcgccctgatcgacgacgggcgcatc
gacgtcaccccgctgatcaccggccgcatcggcctggacaacatcctcgaacagggcttc
gaggagctggccaaccacaaggaccgcaacgtcaagatcatcgtcagtcccggcgcgctg
gccggctga

DBGET integrated database retrieval system