KEGG   Pseudomonas stutzeri RCH2: Psest_1821Help
Entry
Psest_1821        CDS       T02391                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00051  Fructose and mannose metabolism
psh00520  Amino sugar and nucleotide sugar metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Psest_1821
   00520 Amino sugar and nucleotide sugar metabolism
    Psest_1821
Enzymes [BR:psh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Psest_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding SCAPER_N BLUF
Motif
Other DBs
NCBI-ProteinID: AGA86367
UniProt: L0GKQ2
Position
1919932..1921341
Genome map
AA seq 469 aa AA seqDB search
MLLPVIIAGGSGSRLWPLSRQLNPKQFLALTDAQLSMLQSTIRRLDGLEAGLPLLICNEQ
HRFLAAEQLRQLSMEQASILLEPVGRNTAPAIALAALQATQEGDDPILLVLAADHLIQDV
DAFHSSIQAAMPFATNGKLVTFGIVPTNPETGYGYIEKGKELGEGGFAVNRFVEKPSLDI
AEEYLASGEYFWNSGMFMFRASRYLDELERHQPSILAACRQALAAGTQDMHFVRVDAATF
AACPEDSVDYAVMEKTNDAVMVPLDAGWSDVGSWTALWEASNKDAEGNVFKGDVLGHATR
NSFVHADSRLVATLGVEDLVIVETKDAVLVAHKNQVQDVKKLVERIKADNRHEHLNHREV
YRPWGVYDAIDSGHRYQVKRITVQPGAKLSVQMHHHRAEHWVVVSGTAKVTNGDKTYLVT
ENQSTYIPVGQVHALENPGVIPLELIEVQSGSYLGEDDIVRFEDQYGRA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaccggtaatcatagccggcggttcgggctcgcgtctgtggccgttatcgcgg
cagcttaatcccaagcagtttctggcgttgaccgatgcgcagttatccatgttgcagtcg
accatccgccggctggatggtctcgaagcgggtttgcctctgctgatctgcaacgagcag
catcggttcctcgctgcagagcagctccgccagttgagtatggagcaggccagtattctg
ctcgagcctgttggacggaatacagcaccggcaatcgccttggctgcgttgcaggcaaca
caggagggcgatgacccgattctgctcgtgttggccgcggatcacctgattcaggatgtg
gacgcctttcactccagtatccaagcggcgatgccgttcgctaccaatggcaagctcgtt
acgttcggcatcgttccgacgaatccggaaaccgggtacggctatatagagaaaggcaag
gagctgggcgagggcggctttgcggtgaaccgcttcgtggaaaagccgagtctggatatc
gcagaggaatacttggcgagtggtgagtacttttggaacagcggtatgttcatgttccga
gctagccggtatctggacgagttggagcgtcaccagccgtcaatacttgcggcttgtcgt
caggcgctcgcggccggaacgcaggatatgcatttcgttcgggtagatgcagccacattt
gctgcctgtccggaggactccgttgactatgccgtgatggagaagacaaacgatgcagtc
atggtgccgctagatgctggttggagcgacgttgggtcttggacggcgctctgggaggcc
agtaacaaggatgctgaaggaaatgtgttcaagggcgacgtcctcggccacgccactcgc
aattcctttgttcacgctgacagccgcctggtggcaacgctgggggttgaagatttggta
atcgtagagaccaaagacgctgtgctggtcgcccataaaaaccaggtgcaagacgtcaag
aagctcgtcgagcgcatcaaagctgataatcgccacgagcacctcaatcacagggaggtc
tatcgtccttggggggtgtatgacgccatcgacagcgggcaccgttatcaagtcaagcgc
attaccgtccaaccgggcgccaagctgtctgtgcagatgcatcatcatcgggctgagcat
tgggtcgtggtcagcgggactgccaaggtgactaacggcgataagacttacttggtcacc
gaaaaccaatcgacctacataccggtaggccaagtccatgcactggaaaaccccggagta
atcccattggagctgattgaagttcagtcgggttcttatctgggcgaagacgatattgtg
cggttcgaagatcagtatgggcgcgcgtaa

DBGET integrated database retrieval system