KEGG   Pseudomonas stutzeri RCH2: Psest_2024Help
Entry
Psest_2024        CDS       T02391                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent, prokaryotic type
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00020  Citrate cycle (TCA cycle)
psh00480  Glutathione metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
psh01210  2-Oxocarboxylic acid metabolism
psh01230  Biosynthesis of amino acids
Module
psh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psest_2024
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Psest_2024
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Psest_2024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AGA86558
UniProt: L0GIK4
Position
2144486..2145742
Genome map
AA seq 418 aa AA seqDB search
MGYQKIQVPSSGDKITVNADNTLNVPNNPIIPYIEGDGIGVDISPVMIKVVDAAVQKAYG
GQRKIAWMEIYAGEKATQVYDQDTWLPKETLEAVRDYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCQRPVRWFTGVPSPVKKPGDVDMVIFRENSEDIYAGVEWKAGSPEAEKVIKF
LTEEMGVKKIRFTENCGIGIKPVSLEGTKRLVRKALQYAVDNDRSSVTIVHKGNIMKFTE
GAFKEWGYEVARDEFGAELLDGGPWMQFKNPNTGKNIVVKDAIADAMLQQILLRPAEYDV
IATLNLNGDYLSDALAAEVGGIGIAPGANLSDTVAMFEATHGTAPKYAGQDKVNPGSLIL
SAEMMLRHMGWVEAADLIIKSTESAIAAKTVTYDFERLMEGAQLMSCSQFGDAMISHM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggataccaaaagatccaggtgccatccagcggtgacaaaattaccgttaatgccgac
aacaccctgaacgtccccaacaacccgatcattccttatatagaaggggatggtatcgga
gtcgatatcagcccggtgatgatcaaagtcgtggatgccgccgtgcagaaggcctatggc
ggtcagcgcaagattgcctggatggaaatctacgcgggcgagaaggcgacacaggtctac
gaccaggacacctggctgccgaaggagaccctggaagccgttcgtgattacgtggtgtca
atcaagggccccctgaccactccggtcggcggtggcatccgctccttgaacgttgcgctg
cgccaagagcttgatctctacgtctgtcagcgtccggttcgctggttcaccggtgtgcct
agcccggtcaagaagccgggtgacgttgacatggtgatctttcgtgaaaactccgaagac
atctacgccggcgtagagtggaaggctggctcccctgaggcggagaaagtcatcaagttc
cttaccgaagaaatgggcgtcaagaagattcgcttcacagaaaactgtggcatcggcatc
aagccggtttcactggaaggcaccaagcgcttggttcgtaaagccctgcagtacgcggtc
gacaatgaccgtagctcggtcactatcgtgcacaaaggcaacatcatgaagttcaccgaa
ggtgccttcaaggagtggggctatgaggtggctcgcgacgagttcggcgctgagctgctg
gatggtgggccctggatgcagttcaagaatccgaataccggcaagaatatcgtcgtgaaa
gacgccatcgctgacgccatgctgcaacagattctgctgcgcccggctgagtacgatgtc
attgccacgctcaacctgaacggtgactacttgtccgatgccttggccgccgaagtgggc
ggtatcggtatcgctcctggcgcgaacctgtccgacaccgtagccatgttcgaggcgacc
cacggcactgcgccgaagtacgccggccaagataaggtcaaccccggctctttgattctt
tccgccgagatgatgctgcgtcacatgggctgggtagaagcagcggacctgatcatcaag
tcgaccgaaagcgctatcgcagccaagaccgtgacctacgacttcgagcggctgatggaa
ggcgcgcagctgatgtcatgctcgcagttcggcgatgcaatgatcagtcatatgtaa

DBGET integrated database retrieval system