KEGG   Pseudomonas stutzeri RCH2: Psest_2386Help
Entry
Psest_2386        CDS       T02391                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00790  Folate biosynthesis
psh01100  Metabolic pathways
Module
psh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psest_2386
Enzymes [BR:psh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Psest_2386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI MAPKK1_Int
Motif
Other DBs
NCBI-ProteinID: AGA86908
UniProt: L0GJH7
Position
2539131..2539688
Genome map
AA seq 185 aa AA seqDB search
MNDLPGHYREILSGVGENPEREGLRDTPLRAAKAMQYLCGGYNRSLEEVVNGALFASDND
EMVIVKDIELYSLCEHHILPFIGKAHVAYIPTGRVLGLSKVARIVDMYARRLQIQENLTR
QIAEAIQEVTGAAGVAVVIEAKHMCMMMRGVEKQNSVMNTSVMLGAFRSSCNTRMEFLQL
IGRGQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctgcccggtcattaccgcgaaatactgtctggcgtgggtgagaacccggag
cgcgaaggcttgcgcgacacaccgctgcgggccgcgaaggccatgcagtacctgtgtggc
ggttacaaccgtagcctggaagaagtggtcaatggcgcactgttcgcctctgacaatgac
gagatggtcatcgtcaaggacatcgagctgtactcgctgtgcgagcaccacatcctgccc
ttcatcggcaaggcgcatgtcgcctatatccccaccggccgcgtgctcggtctgtccaag
gtggcgcgcatcgttgacatgtacgcccgccgcctgcagattcaggagaacctgacccgc
cagatcgccgaagccattcaggaagttaccggcgctgccggtgttgcggtggtcatcgaa
gccaagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcggtgatgaacacg
tcggtgatgcttggtgccttccgcagctcctgcaacacgcggatggagtttctccagctg
atcgggaggggtcagtaa

DBGET integrated database retrieval system