KEGG   Pseudomonas stutzeri RCH2: Psest_2446Help
Entry
Psest_2446        CDS       T02391                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00071  Fatty acid degradation
psh00072  Synthesis and degradation of ketone bodies
psh00280  Valine, leucine and isoleucine degradation
psh00310  Lysine degradation
psh00362  Benzoate degradation
psh00380  Tryptophan metabolism
psh00620  Pyruvate metabolism
psh00630  Glyoxylate and dicarboxylate metabolism
psh00640  Propanoate metabolism
psh00650  Butanoate metabolism
psh00900  Terpenoid backbone biosynthesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
psh01212  Fatty acid metabolism
psh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psest_2446
   00630 Glyoxylate and dicarboxylate metabolism
    Psest_2446
   00640 Propanoate metabolism
    Psest_2446
   00650 Butanoate metabolism
    Psest_2446
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psest_2446
   00072 Synthesis and degradation of ketone bodies
    Psest_2446
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psest_2446
   00310 Lysine degradation
    Psest_2446
   00380 Tryptophan metabolism
    Psest_2446
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psest_2446
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psest_2446
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psest_2446
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psh04147]
    Psest_2446
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psest_2446
Exosome [BR:psh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psest_2446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AGA86968
UniProt: L0GJR5
Position
complement(2615025..2616209)
Genome map
AA seq 394 aa AA seqDB search
MKDDPIVIVSSARTPMGGFQGDLLGMTAPQLGAAAIRAAVERSGLPAENVQDVLMGCVLP
AGQGQAPARQAALGAGLTRATTCTTVNKMCGSGMQTVIMAHDQLLAGSAEIVVAGGMESM
SNAPYLLDRARGGYRMGHGRVLDHMFLDGLEDAYDKGRLMGTFAEECADAFGFTREEQDA
FALESLRRAQAAIAEGHFADEIVALDVTQGKQQRQIRDDEQPPKAMPEKIPSLRPAFREG
GTVTAANSSSISDGAAALLLMRRSEAERWGLQPQAVIHGHAAYADAPNLFTTAPIGAIRK
LMERTGWSTGDVDLFEINEAFAVVAMASMRELGLDHAKVNVNGGACALGHPIGVSGARIL
VTLLAALRKRGLRRGVAAICIGGGEATAMAVELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgatccgatcgtaatcgtcagcagcgcgcgtacgcccatgggtggtttccag
ggtgatctgctgggcatgacggcaccgcagctcggcgctgccgccatccgcgcggcggtg
gagcgcagcggcctgccggccgagaacgtgcaggacgtgctgatgggctgtgtgctgccc
gccggccagggccaggcgccagcgcgccaggcggctctgggcgccgggctgacccgcgcc
accacctgcaccacagtgaacaagatgtgcggctcgggcatgcagacggtaatcatggct
cacgaccagttgctcgccggcagcgcggaaatcgttgtcgccggcggcatggaaagcatg
agcaacgcgccttatctgctcgatcgtgcccgtggcggctatcgcatggggcacggccgg
gtgctcgaccacatgtttctcgatggtctggaagacgcctacgacaagggccgcctgatg
ggcacctttgccgaggagtgcgccgacgccttcggcttcacccgtgaggagcaggatgcg
ttcgcgctggaatcgctgcgacgggcccaggcggcaatcgccgaagggcactttgccgat
gagatcgtcgcgctggacgtcactcagggcaaacagcagcggcagatccgcgatgacgag
cagccgcccaaggcgatgccggaaaagattcccagcctgagaccagcgttccgcgagggc
ggcacggtgactgcggccaactccagctcgatttccgatggcgccgccgcgctgctgttg
atgcgacgttccgaagccgagcgctggggcctgcagccacaggcggtgatccacggccac
gcggcctacgccgatgcgccgaatctgttcaccaccgcgccgatcggcgcgatccgcaag
ctgatggagcgcaccggctggtccaccggagacgtggatctgttcgagatcaacgaagcc
ttcgccgtggtcgccatggccagcatgcgcgagctgggtctggaccacgccaaggtcaac
gtcaacggcggtgcctgtgcgctcggtcaccctatcggtgtgtccggtgcgcgaatcctg
gtgacgctgcttgccgcattgcgcaagcgcggcctgcgccgtggcgtggcggcgatctgc
atcggcggcggcgaagccaccgcgatggccgtcgaactgatctga

DBGET integrated database retrieval system