KEGG   Pseudomonas stutzeri RCH2: Psest_2720Help
Entry
Psest_2720        CDS       T02391                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00071  Fatty acid degradation
psh00280  Valine, leucine and isoleucine degradation
psh00281  Geraniol degradation
psh00310  Lysine degradation
psh00360  Phenylalanine metabolism
psh00362  Benzoate degradation
psh00380  Tryptophan metabolism
psh00410  beta-Alanine metabolism
psh00627  Aminobenzoate degradation
psh00640  Propanoate metabolism
psh00650  Butanoate metabolism
psh00903  Limonene and pinene degradation
psh00930  Caprolactam degradation
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01212  Fatty acid metabolism
Module
psh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psest_2720
   00650 Butanoate metabolism
    Psest_2720
  Lipid metabolism
   00071 Fatty acid degradation
    Psest_2720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psest_2720
   00310 Lysine degradation
    Psest_2720
   00360 Phenylalanine metabolism
    Psest_2720
   00380 Tryptophan metabolism
    Psest_2720
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psest_2720
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psest_2720
   00281 Geraniol degradation
    Psest_2720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psest_2720
   00627 Aminobenzoate degradation
    Psest_2720
   00930 Caprolactam degradation
    Psest_2720
Enzymes [BR:psh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psest_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGA87228
UniProt: L0GKF2
Position
complement(2909092..2909781)
Genome map
AA seq 229 aa AA seqDB search
MSELVSYQFEDGVATLTLCNGKVNALSPAVFEALNAALDRAEQDRAIVILTGQPGILSGG
YDLKVMTSSPQNAMALVATGSTFARRMLAHPFPVIVACPGHAIAKGAFLLLSSDYRIGVE
GPFHIGLNEVQIGMTMHHAGIELARDRLRKSAFHRSVINGEMFDPASAVDAGFLDKVVPA
GELLAVAKATAEQLKKINMVAHKNTKLKVRKALLETLDQAIALDQEHFG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctggtctcttaccaattcgaagacggcgtcgccacgctgacgctgtgcaat
ggcaaggtcaatgcgctctcgcctgcggtattcgaggcgctcaacgctgcactggatcgt
gccgagcaggaccgcgcgatcgtgattcttaccgggcagccgggcattctttccggtggc
tacgacctgaaggtcatgacctccagtccacagaacgccatggccctggttgccaccggc
tcgacctttgcgcggcggatgctggcgcacccgttcccggtcatcgtcgcctgcccaggg
catgcgattgccaagggtgcgtttctgctgctgtcttcggattaccgcatcggtgtcgaa
gggccgttccatatcggcctcaatgaagtgcagatcggcatgacaatgcaccatgccggt
atcgaactggcgcgcgaccgtctgcgcaaatccgcattccaccgctcggtgatcaacggc
gagatgttcgatccggcgagcgcggtcgatgccggcttccttgacaaggtagtgccggcc
ggcgagctgttggcagtcgccaaagccacagccgagcagctgaagaagatcaatatggtg
gcgcacaagaacaccaaactgaaagtgcgcaaggcgctgttggagacgctggaccaggcg
atcgccctggaccaggaacacttcggctga

DBGET integrated database retrieval system