KEGG   Pseudomonas stutzeri RCH2: Psest_2990Help
Entry
Psest_2990        CDS       T02391                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00260  Glycine, serine and threonine metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psest_2990
Enzymes [BR:psh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Psest_2990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGA87489
UniProt: L0GQB4
Position
complement(3181193..3182218)
Genome map
AA seq 341 aa AA seqDB search
MSDIDLRSDTVTQPTADMREAMFRAETGDDVYGEDPTVSRLERQLAGDLGFSAAMFVPSG
TMSNLLALMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIEMEADGTLDLRRIEA
AIKPDNFHFARSRLLVLENTMHGKVLPLDYLAAARDFTRQRDLALHLDGARLFNAAVKLG
CDAREITRHFDTVSVCLSKGLGAPVGSVLCGDDAFIAKARRLRKMVGGGMRQAGILAAAG
LYALEHNIDRLADDHRRAEWLGNELAALGFAVEPVQTNMVYVEMGAQATALTAFCAQRGI
RLTPAARLRLVTHLDVHDEHVPRVVGAFAEFAEFAENMGRN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgatctacgcagcgacaccgtaacgcagcccaccgccgatatgcgcgag
gcgatgtttcgtgccgaaaccggcgatgatgtctacggcgaagacccgacggtaagccgc
ctcgaacgtcagctggcgggggatcttggattcagcgcagcgatgttcgtgccctctgga
actatgagcaatctgctggcattgatggcgcactgcgagcgtggcgacgagtacatcgtc
gggcagcaggcgcatacctacaaatacgaggggggtggtgcggctgtgctcggctcgatc
cagcctcagcccatcgaaatggaggccgacggcacgctggatctccggcgtatcgaggct
gcgatcaagccggacaacttccacttcgcccgcagccgcctgctggtgctggaaaacact
atgcacggcaaggtcctgccgctggactatctggctgcggcacgcgatttcacccgccag
cgcgatctggcgttgcatctggacggcgcgcgactgttcaacgccgcggtgaagctcggt
tgcgatgcgcgggagatcacccggcatttcgatacggtatcggtgtgcctgtccaagggc
ctgggcgcgccagtcggttcggtgctgtgcggtgatgacgctttcatcgccaaagccagg
cgcttgcgcaagatggtcggcggcggcatgcgccaggccgggattctcgctgcggcgggg
ctatacgcgctggagcacaatatcgatcgattggccgacgatcatcggcgcgcagaatgg
ctgggcaacgagctggcggcgctgggctttgccgtggagccggtgcagaccaacatggtc
tacgtcgagatgggcgctcaagcgacggcgctgacggccttttgcgcgcagcggggtatc
cggctgacgcctgcggcgcggctgcggctggtcacccatttggatgtgcacgatgagcat
gtgcctcgggtggtcggcgcgttcgccgaatttgccgaatttgccgaaaacatgggccgc
aactga

DBGET integrated database retrieval system