KEGG   Pseudomonas stutzeri RCH2: Psest_3204Help
Entry
Psest_3204        CDS       T02391                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00670  One carbon pool by folate
psh00790  Folate biosynthesis
psh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Psest_3204
   00670 One carbon pool by folate
    Psest_3204
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Psest_3204
    1.5.1.50  dihydromonapterin reductase
     Psest_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGA87699
UniProt: L0GQW4
Position
3374755..3375459
Genome map
AA seq 234 aa AA seqDB search
MHQAPILITGASQRIGLHCAERLLEDGFTVIVTYRRERDSIDRLRTLGASTLKADFSDEA
GITGFIAALREQTASLRAIVHNASEWRPDTPGQEAEAFRQLFQVHMLAPYLINLHCADLL
RHGGPADIVHIGDDVTRKGSKKHIAYAASKAGLDNLTLSFAASLAPAIKVNGIAPALIQF
NPDDDEEYRRKALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHLI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaggctccgattctcatcaccggtgccagccagcggatcggactgcattgcgcc
gaacggctgctggaggacggcttcacggttatcgtcacctaccgccgcgaacgcgacagt
atcgaccgactgcgcacgctcggcgcttccacgctgaaggcggatttcagcgatgaagca
ggtattacgggctttatcgccgcactccgagagcagaccgcaagcctgagagcgatcgtc
cacaacgcatccgaatggcgccccgatactcccggccaggaagccgaggcgtttcgccag
ctgttccaggtgcatatgctcgcgccctacctgatcaatctgcactgcgccgacctgctg
cgccacggcgggccggcggacatcgtgcacatcggcgacgacgtcacccgcaagggcagc
aagaaacatatcgcctatgcggcaagcaaggcggggctggacaacctcacgctgtccttt
gccgccagcctggccccggcgatcaaggtcaacggcattgccccggcgctgatccagttc
aatccggacgacgatgaggaataccggcgcaaggcactggcgaaatctgcgctgggcatc
gaacccggtgccgaggtgatctaccagagcctgcgctacctgctcgacaatccgtatgtc
accggcaccacactgaccgtgaacggcggccgtcatctgatctga

DBGET integrated database retrieval system