KEGG   Pseudomonas stutzeri RCH2: Psest_4218
Entry
Psest_4218        CDS       T02391                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh02025  Biofilm formation - Pseudomonas aeruginosa
psh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psest_4218
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Psest_4218
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_4218
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_4218
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGA88688
UniProt: L0GPL1
Position
complement(4397058..4397576)
AA seq 172 aa
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPT
GQRVHKPLMITKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVI
VDVQSRMPNCQDPNMSHFTHLEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacacccgcgtatctgtccctcgaaggcaccaagcaaggcctgatcaccgccggc
accttcaccgaggactcggttggcaacatcttccaggaaggccatgaggaccagatcctg
gtgcaggccttccagcatcaggtcatcattccgcgtgacccgcagtctggccagccgaca
ggccagcgcgtgcacaagccactgatgattaccaaggtgttcgacaagtcgtcgccgctg
atcttcaacgccctgacttccggcgagcgcctgaacaagtgccgtctggagtggtaccgc
acctcgtccaccggcacccaggaacactacttcaccatcgagctggaagatgcggtgatc
gtcgacgtgcagtcgcgcatgcccaactgccaggacccgaacatgtcccacttcacccat
ctggaagacgtgtacttcacctaccgcaagatcgtttggacccacgaggtttccggcacc
tccggctccgacgactggcgcacccctatcgccggctga

DBGET integrated database retrieval system