KEGG   Pseudomonas stutzeri RCH2: Psest_4246
Entry
Psest_4246        CDS       T02391                                 

Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh02025  Biofilm formation - Pseudomonas aeruginosa
psh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psest_4246
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    Psest_4246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_4246
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_4246
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_33 AAA_29 AAA_16 AAA_21
Other DBs
NCBI-ProteinID: AGA88715
UniProt: L0GTK4
Position
4428515..4432054
AA seq 1179 aa
MKTFFGKLGAVLRRTWVWSLLLVLLLAVVVWFVGPLLAVDDYRFWEASTARLLSISVLFL
GWGLAMVFTSWRASARRKRDAEDQDVQEQLRRDGLIGEEQQELRHRFKQALRTLKTSSLY
RGRSEKWRSELPWYLLIGPQGSGKTSLLDFSGLDFPLNRSEQQRLTKDVSGTRYADWYFA
DHAVLIDTAGRYLTQPDAAVDGSVWDTLLGLLRKRRARPLNGVLVNLPVDQLQGGSELEL
ENLARQTRQRLHEIHQRLNVDVPVYLVLSKADRILGFDDFFEQLSREESDQVLGASFRKE
QNGSDAQVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQIGERLSLFIEL
AFAGNRYQRASQLRGFYLTSAPQLRETLDPLTAGIGRQLGLSSSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWGQRALYAGAFGCLLLFGAAWALNFSGNHERLEQLRD
IAQRLGSERKTIEAGDEALRTLKALDASYAATQVFPPKDEVSWLRRGGLYQGEAVDPTLH
EAYRRDLENLLLPRVARQLEAQIRANLNDREQLLGSLRAYLMLNLAERREAAFLKDWLAA
DWSLRHSGNAVAQQGLNTHFARLLEESFAAYQLNDNLVAKARAQLRSESLAAVVYRMLRD
QARNLPDYRLNTQLGPQASLFVGGDYTIPGFYTQRGYQKLFVAQGADLVSEILRDNWVLG
EGDSLSAKDLGRLLVEMEQLYFRDYAAHWSEAIAQLNILPAGSAAQGAAQLAGLTAANSP
LLQLLLEVRENTRFAGLAEATAGAGELAEAAQGAGGKLGKAAKLATAAAEQAQAALLKNT
PDTARKTLERRFAPLHQLLDENGAAGPELSASLQALDALQLQLASLAHASAPEQAAFEMA
KARMGGQRDAINQLRSSAARLPQPVGKWLGLLAEDSWSLVLTDAYHYLNQRYRNELYASY
RGSLRERYPFSAHSASDVALADFREFFKAQGLADSFFERYLKPFVSGSAGQYQLRRVDGR
GLPLSEHFLAQMSRAQTIRRSFFAENPNEPQILFKLEPYSLDSSLGRADFRFGNQQLEYR
HGPIVQTAFRWPAEADDGRTSLVVEELGGRRVGIEKNTGPWSLFRLIDLMQVDYHSGRDV
LMLKADLGGLRANYLLHAQRSPNPFDLALLRGFKLPATL
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgaagacgttctttggcaagctcggcgccgtactgcgccggacctgggtctggagcctg
ctgctggtcctgctgctggcagtcgtggtgtggttcgtcgggccgctgctggcggtcgac
gactaccgcttctgggaagcgtcgaccgcacgcctgctgagcatcagcgtgctgtttctc
ggctggggcctggccatggtcttcaccagctggcgcgccagcgcgcgcaggaagcgcgac
gcggaagaccaggacgttcaggagcagctgcgccgcgacggcctgatcggcgaagagcaa
caggagttgcgccatcgtttcaagcaggcgctacgcaccctgaagacctccagcctctat
cgcgggcgcagcgagaaatggcgcagcgagctgccctggtacctgttgatcggtccgcag
ggcagcggcaagaccagcctgctggacttctccgggctggatttcccactcaaccgcagc
gaacagcagcgcctgaccaaggacgtctccggcacccgctatgccgactggtacttcgcc
gatcatgccgtgctgatcgacaccgccggccgctacttgacccagcccgatgcagctgtc
gacggcagcgtctgggacaccctgctcggcctgctgcgcaagcgccgcgcgcgtccgctc
aacggcgtgctggtcaacctgccggtggaccagctgcaaggcggcagtgaactggagctg
gagaacctggcccgccagacccgtcagcgcctgcacgagatccatcagcgtctgaacgtg
gacgtgccggtctacctagtgctgagcaaggccgaccggattctcggtttcgacgacttc
ttcgagcagctgtcccgcgaggaaagcgaccaggtgctcggcgcgagtttccgcaaggag
cagaacggcagcgatgcgcaggtggtgcgccaggagttcgaggaactgctgcgccggctg
aacagccaggtgatcctgcgcatgcatcaagagcgcgatacacagcgccgtggccggatc
ctcgacttcccgcatcagctggggcagatcggcgagcgcctgagcctgttcatcgaactc
gcgtttgccggcaaccgctaccagcgtgccagccagctgcgtggcttctacctgaccagc
gcgccgcagctacgcgaaacgctcgacccgctcaccgccggcatcggccgccagctcggc
ctgtccagcagtgcgctgccgaccttccgcagcggtcgtgcgcgctttatcaatcagttg
ctcagccgggtgattttccccgaagccgaactggccggcctcgaccagcgcgaagtgcgc
cgcatcgactggggccagcgtgccctctatgccggcgccttcggctgtctgctgctgttc
ggcgctgcctgggctctgaacttctccggcaaccatgaacgcctggaacagctgcgcgac
atcgcccagcgactcggcagcgagcgcaagaccatcgaggcgggagacgaggcactgcgc
accctcaaggctctggacgcgagctatgcggcgacgcaggtgttcccgccgaaagacgag
gtgtcctggctgcgccggggcggcctgtatcagggcgaagcggtcgacccgacgctgcac
gaggcctaccgccgcgatctggagaacctgctgctgccacgtgtcgcccggcagctggaa
gcgcagattcgcgccaacctgaacgaccgcgagcagctgctcggcagcctgcgcgcctat
ctcatgctcaacctggccgaacgccgtgaagcggccttcctcaaggactggctggccgcc
gactggtcgctgcgccattcgggcaatgccgtggcgcagcaggggctcaacacacacttt
gcgcggctgctggaagaatccttcgctgcataccagctgaacgacaatctggtggccaag
gcccgcgctcagctgcgcagcgaatcgctggcggcagtggtgtaccgcatgctgcgcgac
caggcacgcaaccttcccgactatcggctgaatacgcagctcggcccgcaggcatccctg
ttcgtcggcggcgactatacgattcccggcttctacacccagcgcggctaccaaaaactg
ttcgtcgcccagggcgccgatctggtcagcgagatcctgcgcgacaactgggtactgggc
gaaggcgacagcctcagcgccaaggacctcggccgtctgctggtggaaatggagcagctg
tacttccgcgactatgccgcgcactggagcgaagcgatcgcccaactgaacatcctcccc
gcaggtagtgcggcgcagggtgccgcgcagctcgctgggctcaccgccgccaactcaccg
ctgctgcaactgctgctggaagtacgcgagaacacccgcttcgccggtctggccgaagcg
accgccggggctggcgagctggccgaagcggcgcaaggcgccggcggcaagctcggcaag
gcggccaagctggccaccgcagctgccgagcaggcccaggcagcactgctgaagaacacg
ccggacaccgcgcgcaagaccctggagcgtcgctttgcaccgctgcaccagctgctcgac
gaaaacggcgcggccggccccgagttgagtgccagtctgcaggccctcgacgccctgcag
ctgcagctggcttccctggcccatgccagcgcaccggaacaggccgccttcgaaatggcc
aaggcacgcatgggcggccagcgcgacgccatcaaccagctgcgcagcagcgctgcacgc
ctgccacaaccggtcggcaagtggctggggctgctggccgaagacagctggtcgctggtg
ctcaccgatgcctaccactacctcaaccagcgctatcgcaacgagctctacgccagctac
cgcggctcgctgcgcgagcgttatccgttcagcgcgcacagcgccagcgacgtcgccctc
gccgacttccgcgagttcttcaaggcccagggcctggcggacagctttttcgagcgctac
ctcaagcccttcgtcagcggcagcgctggccagtatcaactgcgccgggtcgacggtcgc
ggcctgccgctgtccgagcactttctggcgcagatgagcagggcgcagaccattcgccgc
agcttcttcgccgagaaccccaacgagccgcagatcctgttcaagctcgagccctattcg
ctggattcgagcctcggtcgcgccgacttccgcttcggcaaccagcagctggagtatcgc
cacgggccgatcgtgcagactgcgttccgctggccggccgaagccgacgacggtcgcacc
agcctggtggtggaagaactcggcggccgtcgtgtcggtatcgagaagaacaccgggccc
tggtcgctgttccgcctgatcgacctgatgcaggtcgactaccacagcggccgcgacgtg
ctgatgctcaaggccgatctcggcggcctgcgcgccaactacctgctgcacgcgcagcgc
tcgccgaatccgttcgacctcgcgctgctgcgcggcttcaagctgccggcgacgctgtga

DBGET integrated database retrieval system