KEGG   Pseudomonas stutzeri RCH2: Psest_4249
Entry
Psest_4249        CDS       T02391                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psest_4249
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psh02044]
    Psest_4249
Secretion system [BR:psh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psest_4249
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: AGA88718
UniProt: L0GPN7
Position
4433774..4435819
AA seq 681 aa
MFNAANETHFSMTLEGVDHDFQVLEFRGREAISQPYRFDLELVSERPDLDLQALLHKPAF
LTFDPAGMGIHGLVHRIAQGESGKRLTRYRLTLVPQLAYLAHRTNQRIFQHLSVPQIIAQ
VLEEHGIQADAYRFQLGPVLYPPREYCVQYDESDLHFVQRLCEEEGIHYHFEHSTRGHVL
VFGDGQTSFARLGQPTAYLQDNGMTADEPVIKRFAVRVATRTSRVGRRDYDFEQPRLLME
ATHRGEPAANAMPQPDLEDYDYPGRFTERARGKHLSQRALERHRHDYRLAEGNSDQPRLV
SGHLLEISDHPRREWNDLWLLTEVLHEGKQPQVLEESVTSHVETGDGFIQGYRNHFTATP
WDIPFRPALRHPKPKVLGSQTAVVTGPAGEEIHCDEYGRVRVQFHWDREGQADDKTSCWL
RVSSSWAGDRYGGIAIPRVGMEVLVTFLEGDPDQPLVTGCLYHKEHQVPYDLPANKTRTV
FKTLSSPGGGGYNELRIEDRKGQEQIYIHAQRDWDENIEHDQKSRVGNERHDTVDANSYS
EFRAEEHQTVAGDRKVEVKPDDHLTIGQTQHIKLGTAQLTKAGREIHLKAGQKMVIEAGV
ELTLKAGGSFIKLDPGGITVSGPLARINAGGAPGKGSGIKIKPPVLPGMADRDKAGSLLE
QVSASPLNRKKKVKRMMNFSG
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgttcaacgcggccaacgaaacccacttcagcatgaccctggagggcgtcgatcacgac
ttccaggtgctcgaattccggggccgcgaggccatcagccagccctaccgcttcgacctg
gaactggtcagcgagcgccccgacctcgatctgcaggcactgctgcataagcccgccttt
ctcaccttcgaccccgccggcatgggcatacacggcctggtccaccgtatcgcccagggc
gaatccggcaagcgcctgacccgctatcggctcacgctcgtgccgcagctggcctacctc
gcccatcgcaccaaccagcgcatattccagcacctcagcgtgccgcagatcatcgcccag
gtgctcgaagagcacggtatccaggccgacgcctaccgcttccagctcggcccggtgctc
tacccgccacgcgagtactgcgtgcagtacgacgaatcggacctgcacttcgttcagcgc
ctgtgcgaggaagaaggtatccattaccacttcgagcacagcaccagaggtcatgtgctg
gtcttcggcgatggccagaccagcttcgcccgactcggccagccgaccgcctatctgcag
gacaacggcatgacggctgacgagccggtgatcaagcgcttcgccgtgcgcgtcgcgaca
cgcaccagccgggtcggccgtcgtgattacgacttcgaacaacccaggctgctgatggag
gcaacccaccgcggcgagccagcggcgaacgccatgccgcaacccgacctggaggactac
gactacccgggccgcttcaccgagcgcgcccgcggcaaacacctgtcgcaacgcgcgctg
gagcgccaccgccacgactaccgcctggccgagggcaacagcgaccagccgcggctggtc
agcggccatctgctggaaatctccgaccacccgcgccgcgaatggaacgacctctggctg
ctgaccgaagtgctgcatgaaggcaagcagccgcaggtgttggaggagtcagtcaccagc
catgtcgaaactggcgacggcttcatccagggctaccgcaaccacttcaccgctacgccc
tgggatatccctttccgcccggcccttcgccatccgaaaccgaaggtcctcggcagccag
accgccgtggttaccgggcccgctggcgaagaaatccactgcgacgagtacggccgcgtg
cgcgttcaattccactgggatcgcgaaggccaggccgacgacaagaccagctgctggctg
cgcgtcagctcaagctgggccggcgaccgctacggcggcatcgcgatcccgcgcgttggc
atggaagtgctggtgaccttcctcgaaggcgatcccgatcaaccgctggtcaccggctgc
ctgtatcacaaggagcatcaggtcccctacgacctgccggccaacaagacccgcacggtg
ttcaagaccttgagtagcccgggcggtggcggctacaacgaactgcgcatcgaagaccgt
aagggccaggaacagatttatatccacgcccaacgcgactgggacgaaaacatcgagcac
gaccagaagagccgcgtcggtaatgaacgccacgacaccgtggacgccaacagctacagc
gaattccgcgccgaggaacaccagaccgttgccggcgaccgcaaagtggaagtcaaacct
gacgaccacctcaccatcggccagacccagcacatcaagctcggcaccgcccagctgacc
aaggccggccgcgagatccacctcaaggccggccagaagatggtcatcgaagccggcgtc
gaactcacgcttaaagccggaggcagcttcattaagctcgacccaggcggcatcaccgtc
tctggcccgctagcgcgaatcaacgccgggggcgcgccgggcaagggatcgggaatcaag
atcaagccgccggtgctgccggggatggctgatagggataaggcggggagtttgttggag
caagtttccgccagtccgctcaaccgaaaaaagaaagtcaaaagaatgatgaatttttca
ggctga

DBGET integrated database retrieval system