KEGG   Pseudomonas stutzeri RCH2: Psest_4317Help
Entry
Psest_4317        CDS       T02391                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00010  Glycolysis / Gluconeogenesis
psh00071  Fatty acid degradation
psh00350  Tyrosine metabolism
psh00625  Chloroalkane and chloroalkene degradation
psh00626  Naphthalene degradation
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_4317
  Lipid metabolism
   00071 Fatty acid degradation
    Psest_4317
  Amino acid metabolism
   00350 Tyrosine metabolism
    Psest_4317
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psest_4317
   00626 Naphthalene degradation
    Psest_4317
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psest_4317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AGA88786
UniProt: L0GRZ9
Position
complement(4517162..4518145)
Genome map
AA seq 327 aa AA seqDB search
MRAMLLEITGEPLHLRDIPEPQPGPGELRVRVLACGVCRTDLHVVDGELPAAPLPIIPGH
EIVGRVDALGEGVSGFELGQRVGIPWLGHTCGTCSYCQHAEENLCDAPQFTGYTRPGGYA
EYVVADARFAFDLGEQGDAVALAPLLCAGLIGWRSLVKAGDGKRLGLYGFGAAAHIVMQV
ARWQGRDVYAFSRPGDVAAQDFARSLGAVWAGDSGELPPVPLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYDILWQERELVSVANLTRQDGLEFFPVAAQVGIHTETH
AYPLEQANQALDDLRHGRFQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatgttgctggaaataacgggcgaaccgctgcacttgcgtgacattcccgag
ccgcaacccggccctggggagctgcgggtcagagtgctggcctgcggcgtctgtcgcacc
gacctgcacgtggtggatggcgagctgccggcggcgccgctgccgatcattcccggccac
gaaatcgttggccgcgtcgatgcgctgggcgaaggcgtcagcggtttcgagctgggccag
cgggtcggcattccctggctcgggcatacctgcggcacctgcagctactgccagcacgcc
gaggaaaacctctgcgacgcgccgcagttcactggttacacccggcccggcggctatgcc
gaatacgtggtggccgacgcgcgcttcgccttcgaccttggcgagcaaggcgatgccgtg
gcactggcgccgctgctctgcgccgggctgatcggctggcgctcattggtcaaggccggc
gacggcaagcgtctcgggctgtacggcttcggcgccgcggcgcatatcgtcatgcaggtg
gcgcgctggcaggggcgtgatgtctacgccttcagccgcccgggcgatgtggccgcgcag
gacttcgcccgttcgctgggtgcggtttgggccggggattcaggggagctgccaccggtg
ccgctggatgcggcgatcatctatgcaccggccggtgagctggtgccggcggcgctgcga
gccgtgcgcaagggcggccgggtggtctgcgccggcatccacatgagtgatattccgagc
ttcccctacgacatcctctggcaggagcgcgaactggtctcggtggccaacctgacccgc
caggacggcctggagttcttcccggtcgccgcccaggtcggcatccataccgagacccat
gcctacccgctggaacaggccaaccaggcgctggatgacctgcgccatgggcgctttcag
ggtgctgcggtgctggtgccgtga

DBGET integrated database retrieval system