KEGG   Plesiomonas shigelloides: SAMEA2665130_0551Help
Entry
SAMEA2665130_0551 CDS       T04378                                 

Gene name
aceB
Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pshi  Plesiomonas shigelloides
Pathway
pshi00620  Pyruvate metabolism
pshi00630  Glyoxylate and dicarboxylate metabolism
pshi01100  Metabolic pathways
pshi01110  Biosynthesis of secondary metabolites
pshi01120  Microbial metabolism in diverse environments
pshi01200  Carbon metabolism
Module
pshi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pshi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA2665130_0551 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA2665130_0551 (aceB)
Enzymes [BR:pshi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SAMEA2665130_0551 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI TPR_10
Motif
Other DBs
NCBI-ProteinID: SBT60115
Position
1:602781..604391
Genome map
AA seq 536 aa AA seqDB search
MSGQHNTSAQHPLLTCTEPLTAEQQAILTPQALDFLAELVTRFAPQVPQLLAAREAFQAQ
IDAGALPDFLPETEHIREKAWTIRGVPADLRDRRVEITGPVERKMIINALNANVKVFMAD
FEDSLAPAWDKVIQGQINLRDAVDGTIEYRSEEGKSYRLNAHPAVLICRVRGFHLQEKHM
RYQGEPIPGNLFDFALYFFHNHQRLLAKGSGPYFYLPKMQSYHEAAWWSEVFSFAEDHVG
LARGTIKATALIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDKVLPD
RQVVTMDKPFLSAYSRLLIRTCHRRGAFAMGGMAAFIPSKDPARNEWVLNKVRADKELEA
GNGHDGTWVAHPGLADVAMAVFDRVLDGRANQLDVRREHDEPVTAADLLQPCEGERTEEG
MRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIRHQKRLSNGKLVTKA
LFSAMLREELATLRDELGAEKYDTGRYEEAAALMEQITVSDELVNFLTLPGYRYLN
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagcggacaacacaatacttcggcgcagcacccgctgctgacctgtactgagcctctg
accgcagagcagcaggccatccttaccccacaggcattggattttctggccgagctggtg
acccgtttcgccccgcaggtaccgcaattgctggcggcccgtgaagcgttccaagcgcag
attgatgccggtgcattgcctgattttctgcctgaaaccgagcacattcgcgaaaaagcc
tggactatccgtggcgtgcctgccgatttgcgcgatcgccgcgtagagatcaccggccct
gttgaacgcaaaatgatcatcaatgccttaaatgccaacgttaaagtcttcatggcggat
ttcgaagactccttggctccggcgtgggataaagtgatccaagggcaaatcaacctgcgc
gatgcagtggatggcaccattgaatatcgcagcgaagaaggtaaatcctaccgactcaat
gcccatccggcggtgctgatttgtcgggtgcggggcttccatctgcaagaaaaacatatg
cgctatcaaggcgagcctattcccggcaacctgtttgattttgcactctactttttccat
aaccatcagcgtttgctggccaaaggcagcggcccgtatttctacctgccgaagatgcag
tcatatcacgaagctgcatggtggagtgaggtgttcagtttcgccgaagatcatgtcggc
ttggcgcgcggcaccatcaaagcgacggccttgatcgagactctgcctgccgtgtttcag
atggatgagatcctatatcacctgcgagaccacattgtcggcctgaactgtggtcgttgg
gactacatctttagctatatcaaaacactgaaaaatcaccccgataaagtcctgccagat
cgccaagtggtgaccatggacaaaccgttcttgagtgcctattcgcgcctactgatccgt
acctgtcatcgccgtggcgcatttgccatgggcggtatggcggcctttattccaagcaaa
gatccggcgcgtaatgagtgggtgctgaataaagtgcgcgcggataaagagctggaagcc
ggtaatggacatgacggcacgtgggtagcccaccccggccttgccgatgtggcgatggca
gtgttcgaccgcgtactcgatggccgcgccaatcaactggatgtgcgccgcgagcatgat
gagccggtcactgcggcggatttgctgcaaccttgtgagggcgagcgtaccgaagagggc
atgcgcgccaatattcgagtggcggtgcagtacatcgaggcgtggatctccggtaacggc
tgtgtgcccatttacggtctgatggaagatgcggctaccgctgagatttcgcgtacctca
atttggcagtggatccggcaccaaaaacgcttaagtaacggcaagttggtgaccaaagct
ttgttcagcgccatgttgcgcgaagagctggcgaccttacgtgatgagttaggcgccgag
aaatatgatacaggtcgctatgaggaagcggcggccttgatggagcaaatcacggtatcg
gatgagctggtcaactttctgactttgcctggctaccgttatctgaactga

DBGET integrated database retrieval system