KEGG   Plesiomonas shigelloides: SAMEA2665130_2024Help
Entry
SAMEA2665130_2024 CDS       T04378                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pshi  Plesiomonas shigelloides
Pathway
pshi00071  Fatty acid degradation
pshi00280  Valine, leucine and isoleucine degradation
pshi00310  Lysine degradation
pshi00362  Benzoate degradation
pshi00380  Tryptophan metabolism
pshi00620  Pyruvate metabolism
pshi00630  Glyoxylate and dicarboxylate metabolism
pshi00640  Propanoate metabolism
pshi00650  Butanoate metabolism
pshi00900  Terpenoid backbone biosynthesis
pshi01100  Metabolic pathways
pshi01110  Biosynthesis of secondary metabolites
pshi01120  Microbial metabolism in diverse environments
pshi01130  Biosynthesis of antibiotics
pshi01200  Carbon metabolism
pshi01212  Fatty acid metabolism
pshi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pshi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA2665130_2024 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA2665130_2024 (thlA)
   00640 Propanoate metabolism
    SAMEA2665130_2024 (thlA)
   00650 Butanoate metabolism
    SAMEA2665130_2024 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAMEA2665130_2024 (thlA)
   00072 Synthesis and degradation of ketone bodies
    SAMEA2665130_2024 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMEA2665130_2024 (thlA)
   00310 Lysine degradation
    SAMEA2665130_2024 (thlA)
   00380 Tryptophan metabolism
    SAMEA2665130_2024 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA2665130_2024 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMEA2665130_2024 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAMEA2665130_2024 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pshi04147]
    SAMEA2665130_2024 (thlA)
Enzymes [BR:pshi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMEA2665130_2024 (thlA)
Exosome [BR:pshi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA2665130_2024 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: SBT61527
UniProt: A0A1A9AZ41
Position
1:complement(2235049..2236230)
Genome map
AA seq 393 aa AA seqDB search
MSKEIVVLSAVRTPMGGFQGSLSGFTAPQLGAEVVKAAIERAGIQPAQVDEVLLGCVLPA
GLGQAPARQAALAAGVPDSVPCTTVNKVCGSGMKTLMQGAAALKLGEADVVVAGGMESMS
QAPYLMPAARTGLRMGHGAVKDHMFTDGLEDAYSGKLMGVLAQQMADKRGVTREAMDNFA
INSLAKANAAIAQGAFEAEIVPVTVVTRSGNTQVCIDEQPGNAKPEKIPGLRPAFAKDGT
ITAANSSSISDGAAALVLSTADYAAQNGCKPLARIVSYASHAQAPEEFTVAPVGAIRKAI
DLAGWTPDDIDLFEVNEAFAMVTLLAIEDVGLDSNKVNVHGGACALGHPLGASGARVVVS
LIHALRRYGKKRGLAALCIGGGEGVAMTVELID
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagagattgtggtgttgtctgctgtgcgtactccgatgggtggttttcagggc
agtctgtccggatttactgcaccacaattgggggcggaagtggtgaaagcggccattgag
cgtgcaggcattcaaccggcgcaggtggatgaagtgttgttaggttgcgttttgcctgcg
ggattgggccaagcacctgcgcgtcaggcggcattagcggccggagtaccggatagcgtg
ccttgcaccacggtgaacaaagtgtgtggctccggcatgaaaaccttgatgcaaggggct
gccgcgctcaaactcggggaggccgatgttgtggtggctggtggaatggagagcatgtca
caagccccgtacctgatgccagcggcccgtaccggtttgcgaatggggcatggcgcggtg
aaagatcacatgtttaccgatgggctggaagatgcctacagcggcaagctgatgggcgtt
ctggcgcagcaaatggccgataagcgtggcgtgacgcgcgaggcgatggataactttgct
atcaactcactggctaaagccaatgcggccattgcgcagggggcatttgaagcagagatt
gtgccggtcaccgtggtaacccgtagcggtaatacgcaagtgtgtatcgatgagcagcca
ggcaatgccaaaccggagaaaattccgggtctgcgtccggcctttgctaaagacggcacc
attaccgcggctaactccagttcaatttctgatggtgcggcagctttagtgctgagtacc
gctgattatgccgcgcaaaatggctgtaagccgctggcgcgcattgtctcttatgcttcc
catgcgcaggcgccagaagagtttaccgtggcaccggtgggcgcgatccgtaaagccatt
gatctggctggctggacgccagacgatatcgacttgttcgaggtcaacgaagcctttgcg
atggtgaccttgctggcgattgaagatgtcggtttagacagcaataaagtcaacgtacat
ggcggagcgtgtgctcttggtcatcccttgggcgccagtggggcgcgggtggtggtgagc
ttgatccatgccctgcgtcgctacgggaaaaagcgtggattggccgcactgtgcatcggt
ggcggtgaaggtgtggctatgaccgtcgagctgattgattaa

DBGET integrated database retrieval system