KEGG   Providencia stuartii MRSN 2154: S70_00665Help
Entry
S70_00665         CDS       T02042                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00040  Pentose and glucuronate interconversions
psi00052  Galactose metabolism
psi00500  Starch and sucrose metabolism
psi00520  Amino sugar and nucleotide sugar metabolism
psi01100  Metabolic pathways
psi01130  Biosynthesis of antibiotics
Module
psi_M00362  Nucleotide sugar biosynthesis, prokaryotes
psi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S70_00665
   00052 Galactose metabolism
    S70_00665
   00500 Starch and sucrose metabolism
    S70_00665
   00520 Amino sugar and nucleotide sugar metabolism
    S70_00665
Enzymes [BR:psi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     S70_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFH92034
UniProt: A0A140NE80
Position
complement(126752..127690)
Genome map
AA seq 312 aa AA seqDB search
MTKMTNRKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVL
VTHSSKNSIENHFDTSFELEAILEARVKRQLLDEVQSICPSHVTIMQTRQGIAKGLGHAI
LCAKPLVGNEPFAVILPDVILDRYSTDLTKFNLSEMLAHFEETGASQILVEPVPEDEVSN
YGIVDCNGATLLPGESKPISRMVEKPKKEEAPSNLSIVGRYVLSEKIWDALAKTAPGAGD
EIQLTDAIAIMMENKSPVEAYHLCGKSHDCGNKLGYMKAFVEYGMQHDSLGEDFSEWIQT
ISNKLNSSKAEK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatgacaaatagaaaggtacgcaaggcagtaatccctgtcgcaggtcttggc
actcgtatgttacccgcgactaaagcaattcccaaagagatgttaccactcgttgataaa
cctttaattcagtatgttgttaatgagtgtatcgctgctggtattaatgaaattgtttta
gtgactcattcatcaaaaaactcgattgaaaaccacttcgatacgagtttcgagcttgag
gcaattttagaagctcgtgttaagcgtcaattactcgatgaagtgcaatctatctgccca
agtcacgtaactatcatgcaaacgcgtcaaggtattgctaaaggcttaggtcatgcgatt
ttatgtgctaagcctcttgtggggaatgagccttttgcggttattctgcccgatgttatt
ttagatcgttatagcaccgatttaaccaagtttaatttgagcgaaatgctggcccatttt
gaagaaacgggagcaagccaaattttggttgagcccgttcctgaagatgaagtttctaat
tatgggattgtagattgtaatggtgcaacgttgcttcctggtgaaagcaaaccgattagc
cgcatggtagaaaaaccgaagaaagaagaagcaccatcaaatctgtcgattgttggccgc
tatgtattatcggaaaaaatttgggatgcactagcaaaaacagcaccaggggcaggggat
gaaattcaattaaccgatgctattgcgattatgatggaaaataagtctcctgtagaggcg
taccatctatgtggtaaaagtcatgactgtggtaataagctaggttatatgaaagcattc
gtagaatatggtatgcaacatgattcattaggggaagatttttctgagtggatccaaacc
atatcgaataaattgaacagttctaaagcagaaaaataa

DBGET integrated database retrieval system