KEGG   Providencia stuartii MRSN 2154: S70_09080Help
Entry
S70_09080         CDS       T02042                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00010  Glycolysis / Gluconeogenesis
psi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S70_09080
Enzymes [BR:psi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     S70_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AFH93677
UniProt: A0A140NLX6
Position
complement(1942930..1943544)
Genome map
AA seq 204 aa AA seqDB search
MLYIFDMGNVIIDIDFNRVFDKWSELSGTPSEQIKSRFTFGNIFQQHECGKISDIEFAEM
LCEELGITLSFEEFAEGWHAIFMSVRPEVIDIMERLREQGHRVVVLSNTNRLHLDYWPEH
YPEIAASSDFLYLSQDLGMRKPDPAIYQYVLESEEFDAADAIFFDDVEDNIKAAEALGIK
GVHVVNKDTVPEYFRTYDFNAEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatcttcgatatgggtaatgtgattattgatatcgactttaatcgtgttttt
gataaatggtcagagctgagcggtacgccttctgagcagatcaaatcacggtttactttt
gggaatatcttccaacaacatgagtgtggcaaaatttcagatattgaatttgctgaaatg
ctatgcgaagaactcggcattacactcagttttgaagagtttgcggaaggctggcacgct
atctttatgtcggtgcgcccagaagttattgatataatggagcgcctacgtgagcaaggg
catcgtgttgttgttttatctaacaccaaccgcctacaccttgattactggcctgaacat
taccctgaaattgcagcctcctctgatttcctctacctctctcaagacttggggatgcgc
aaacctgatccagccatttaccaatatgttctggaatctgaagagtttgacgcggcagat
gccatattctttgatgatgttgaggacaatattaaggctgccgaagcgctaggtatcaaa
ggtgttcatgtcgttaacaaagacactgtacctgaatattttcgtacttatgacttcaac
gctgaagtcgaataa

DBGET integrated database retrieval system