KEGG   Providencia stuartii MRSN 2154: S70_09360Help
Entry
S70_09360         CDS       T02042                                 

Definition
(GenBank) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi00071  Fatty acid degradation
psi00280  Valine, leucine and isoleucine degradation
psi00281  Geraniol degradation
psi00310  Lysine degradation
psi00360  Phenylalanine metabolism
psi00362  Benzoate degradation
psi00380  Tryptophan metabolism
psi00410  beta-Alanine metabolism
psi00627  Aminobenzoate degradation
psi00640  Propanoate metabolism
psi00650  Butanoate metabolism
psi00903  Limonene and pinene degradation
psi00930  Caprolactam degradation
psi01100  Metabolic pathways
psi01110  Biosynthesis of secondary metabolites
psi01120  Microbial metabolism in diverse environments
psi01130  Biosynthesis of antibiotics
psi01212  Fatty acid metabolism
Module
psi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    S70_09360
   00650 Butanoate metabolism
    S70_09360
  Lipid metabolism
   00071 Fatty acid degradation
    S70_09360
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S70_09360
   00310 Lysine degradation
    S70_09360
   00360 Phenylalanine metabolism
    S70_09360
   00380 Tryptophan metabolism
    S70_09360
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S70_09360
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S70_09360
   00281 Geraniol degradation
    S70_09360
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S70_09360
   00627 Aminobenzoate degradation
    S70_09360
   00930 Caprolactam degradation
    S70_09360
Enzymes [BR:psi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S70_09360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFH93732
UniProt: A0A140NP52
Position
2004039..2004812
Genome map
AA seq 257 aa AA seqDB search
MQTDWILAHIEHRVLTLTLNRPDVRNALSTDCLELLVDHLEQADKDPQIGAIVIAGNPRF
FAAGADLKELQQQTVAAAITDRRPQVWRRFSQISKPIITAVNGYALGAGFELVLASDVVI
AGETARFGLPEITLGLIPGAGGTQRLVRVVGKSLAMQMVLTGEAIPAQRALQAGLVSQIC
VDGLVVEYAQKLAQRMADHAPLAVRAAKASINAAQEISLSEGLQLERQYFVTLAGTDDRR
EGINAFFEKRQPKFTGQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgattggatcctagctcatattgaacatcgcgtcctaacattgacgttgaat
cgccctgatgtgcgtaacgccttaagtactgattgcctcgaattacttgtcgatcacctt
gaacaagccgataaagacccacaaatcggcgccatcgttattgccggtaacccacgtttt
tttgcggcgggtgctgaccttaaagagctccagcaacaaaccgttgcggcggcgatcacg
gataggcgccctcaagtttggcgtcgtttttcgcaaatttccaaacccattatcaccgca
gtcaatggttatgcattgggtgctggctttgaattagtacttgcaagtgatgtggtcatt
gccggtgaaacggcgcgttttggcttacctgaaatcaccctagggctaatacctggcgcg
ggaggaactcaacgtctggttcgcgtggttggcaaatcccttgcgatgcaaatggtactc
acgggcgaggcgattcctgcacaacgtgccttacaagcaggattagtgagtcaaatttgt
gtggatgggttagttgttgaatacgcacagaaacttgcccaacgcatggcggatcacgcc
ccacttgccgtgagagcggctaaagcatccattaatgcagctcaagaaatctcactttca
gagggattacagcttgagcgccaatattttgtcaccttggcaggtactgatgaccgccgc
gaagggatcaatgctttctttgaaaagcgacagccaaaatttacaggacaataa

DBGET integrated database retrieval system