KEGG   Providencia stuartii MRSN 2154: S70_09535
Entry
S70_09535         CDS       T02042                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
psi  Providencia stuartii MRSN 2154
Pathway
psi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    S70_09535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psi02044]
    S70_09535
Secretion system [BR:psi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   S70_09535
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C Pre-PUA FliJ
Other DBs
NCBI-ProteinID: AFH93767
UniProt: A0A140NM57
Position
complement(2039811..2042579)
AA seq 922 aa
MRIEEVRMTFNSQLPLYIVLTKLDLLRGFDAMFQSLDAQQRNQVLGVSFSSKENVNWEKQ
LNHFWSQWVSQMNSALPEMMLNRSEGSQRSDLFSFVRQIEGLQSSVAKLISALVANNEQK
NIRLRGVYLTSATQVGQIDDVFSQTASVQYHLPTAPLTTWPISDTHPYFTHNLFSDVLFS
EPNLAAENHYWLKKHRTRLLVASTVSIVGLILAWNGWSHYYNKNYRAGENVLNEVKAFKA
IESTTTKDTDGSKQLPVLNPLREATLAYGNHRDKNGILSEMGLYQGQKVGPQVENVYLQL
LTERFLPAIMAGLLIELDNAEKGSEEKLEILRVMRMLEDKSGRNNGLVEDYMANYWSQLF
TGQRDIQAQLRGHLHYALEHTDWKAERNQGSAIANKVFGPFAKPISDAQKELSTLSLYQR
VYQTLRLKANQTLSSPLNLRHQIGPGFNSVFTVNDEDKLEIPQFLTRSGLINYFIRQNDE
LVDLTLLDAWVLNLSSNTQYSESDRKEIQRQISEQYLNDYTAQWRGAMSNLEIREFDTIQ
DEINALEQIISGEQPLRRALQVLRDNTSLPTIDSSLSSQEQQKLMAEPKYRLLSRLDREF
SPETEILVSNNGENLQNLNQKLNELHRYLLSIQNSPVPGKAALKAVSMRLNDNNRDVIFE
LSQMAKTLPEPLNRWVGDLSDQAWNVVQKEAIRYMEVEWNENVVKQYNAYIAGRYPFNPK
SKQDVPLSEFERFFKPNGTIDSFYQQNLRLFVENNLIENMEGQSLIRPDVLEQIEIANRI
RDTFFTAQGNLETQFAVEPLSLSGNKRRSILNLDGQIIDYSHGRSNTVHMVWPNSMRSNI
ESKLTLVPLSGDKSPRSLSFSGPWAQLRLIDSGRLMNVKPNSFEVRFTIDGGDMTYRVQI
DESNNPFFGGLFTRFRLPETLY
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgcgtattgaagaagtccgtatgacattcaatagtcaattaccactctatattgtgttg
actaaactggacttgttacgtggttttgatgcgatgttccaatcccttgatgctcaacag
cgtaatcaggtattaggggtatcttttagctcaaaagaaaatgttaattgggaaaaacag
ctcaatcacttttggagccaatgggttagccaaatgaacagtgctttacctgaaatgatg
ttaaatcgttcagaaggaagccaaagaagcgacttatttagttttgttcgccaaattgaa
gggttacaaagcagtgtagcaaaattaatctctgcattggttgctaacaatgaacagaaa
aatatccgtttaagaggggtttatctcacctctgcgactcaagttggtcagattgacgac
gtctttagccaaacggcgtcagttcaataccatttaccaacagcaccactaacaacttgg
cctatttcagatacacatccctattttacgcacaacttattcagtgatgtgctgtttagc
gagccaaacttagcagcggaaaaccattattggctgaaaaaacatcgtaccagactttta
gttgcttcaactgtcagcattgttggtttgatattggcttggaatggctggagccattac
tacaacaaaaactatcgtgcgggcgagaatgtgcttaatgaagttaaagcatttaaagcg
attgaatcaacgacaactaaagatactgacggtagcaaacaacttcctgttttgaaccca
cttagagaagcaacattagcttacggaaaccatcgtgataaaaatggcattctgtctgaa
atggggttatatcaggggcaaaaagttggaccacaagttgaaaatgtctacttgcaattg
ttaacggaacgctttttacccgccattatggcagggttacttattgagctggataatgct
gaaaaaggcagtgaagagaagctcgaaatcttacgtgttatgcgcatgcttgaagataaa
agtgggcgtaataacgggttggttgaagattatatggcaaactactggagccagctattt
acagggcaacgagatatccaagctcagcttcgcggccatttacattatgcgttagagcac
actgactggaaagctgagcgtaatcaaggttcagcgattgccaataaagtctttgggcca
tttgccaaaccaatcagtgacgctcaaaaagagctgagcacgctgtcgctataccaacgt
gtttatcaaacactgaggctgaaagcgaatcaaacactgtcatcaccattaaacctccgt
catcaaataggccctggttttaactcagtgtttactgtgaacgatgaagataagctcgaa
atccctcagtttctcacccgttctgggctgattaactactttattaggcaaaatgatgaa
ttggtcgatctgacattacttgatgcttgggtgctaaatttatcaagcaatacacagtat
agcgagagtgaccgtaaagagatccaacgtcaaattagcgaacaatatctgaatgactat
actgcgcaatggcgtggagcgatgagtaatttagagattcgtgaatttgacacaattcaa
gatgaaatcaatgcattagaacagataatcagtggtgagcagccgttaagacgtgcatta
caggtactgagagataacacttctttacctaccattgatagttcgctgtcttcacaagag
cagcaaaaattgatggcagagccgaaatacaggttgcttagcaggctggatagagagttt
tcacctgaaactgagatcttagtgagtaacaatggtgaaaacctacaaaatctcaatcag
aagctaaatgaattgcatcgttatttattaagtattcaaaactcaccagtaccaggtaaa
gctgcactaaaagcggtgtctatgcgtttgaatgataataaccgtgatgtcatttttgag
ctatcacaaatggcgaaaacattaccagaaccattaaatcgttgggtaggagacctctcg
gaccaagcatggaatgtggtacaaaaagaagctattcgttatatggaagtcgagtggaat
gaaaacgttgtcaaacagtacaacgcgtacatcgctggacgttatccatttaatccgaaa
tctaaacaagatgtgccattaagcgaatttgaacgtttcttcaaaccaaatggcaccatc
gatagtttctatcaacagaatctacgtttatttgttgaaaataacttgattgaaaatatg
gaaggccaatcgctgattcgccctgatgtattggagcaaattgagattgctaaccgcatt
cgagacaccttctttactgctcaaggtaatcttgaaacacaatttgcggtagaaccgttg
tcactgtcaggtaataaacgtcgcagtatcttgaaccttgatgggcagattattgactac
tctcatgggcgcagtaacaccgtacatatggtgtggccaaactcaatgcgttcaaacatt
gaaagtaagctgacattagtgcctctttctggtgataaatcccctcgttcgctcagcttt
agcggaccttgggcgcaattacgccttatcgatagcggcaggttaatgaatgtgaaacca
aactcttttgaagttcgcttcacaattgatggcggagatatgacttatcgcgtgcaaatt
gatgaatctaacaacccgttcttcggaggattatttacccgattccgtttacctgaaacg
ctttattaa

DBGET integrated database retrieval system